Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4972
Gene name
Locationscaffold_4:69468..74020
Strand+
Gene length (bp)4552
Transcript length (bp)4383
Coding sequence length (bp)4380
Protein length (aa) 1460

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18404 Glyco_transf_24 Glucosyltransferase 24 2.2E-149 1146 1412
PF18402 Thioredoxin_14 Thioredoxin-like domain 5.9E-64 381 623
PF18403 Thioredoxin_15 Thioredoxin-like domain 4.9E-57 635 831
PF18400 Thioredoxin_12 Thioredoxin-like domain 2.0E-41 23 199
PF18401 Thioredoxin_13 Thioredoxin-like domain 4.4E-38 249 375
PF06427 UDP-g_GGTase UDP-glucose:Glycoprotein Glucosyltransferase 3.1E-39 1001 1109

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09140|UGGG_SCHPO UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpt1 PE=1 SV=2 6 1415 0.0E+00
sp|Q09332|UGGG_DROME UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster GN=Ugt PE=1 SV=2 16 1414 0.0E+00
sp|Q9NYU2|UGGG1_HUMAN UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens GN=UGGT1 PE=1 SV=3 11 1413 0.0E+00
sp|Q6P5E4|UGGG1_MOUSE UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus GN=Uggt1 PE=1 SV=4 11 1413 0.0E+00
sp|Q9JLA3|UGGG1_RAT UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus GN=Uggt1 PE=1 SV=2 11 1413 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09140|UGGG_SCHPO UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpt1 PE=1 SV=2 6 1415 0.0E+00
sp|Q09332|UGGG_DROME UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster GN=Ugt PE=1 SV=2 16 1414 0.0E+00
sp|Q9NYU2|UGGG1_HUMAN UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens GN=UGGT1 PE=1 SV=3 11 1413 0.0E+00
sp|Q6P5E4|UGGG1_MOUSE UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus GN=Uggt1 PE=1 SV=4 11 1413 0.0E+00
sp|Q9JLA3|UGGG1_RAT UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus GN=Uggt1 PE=1 SV=2 11 1413 0.0E+00
sp|Q9NYU1|UGGG2_HUMAN UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens GN=UGGT2 PE=1 SV=4 5 1414 0.0E+00
sp|Q0WL80|UGGG_ARATH UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana GN=UGGT PE=1 SV=1 11 1409 0.0E+00
sp|Q8T191|UGGG_DICDI Probable UDP-glucose:glycoprotein glucosyltransferase A OS=Dictyostelium discoideum GN=ggtA PE=1 SV=2 767 1409 7.0E-153
sp|P22023|KRE5_YEAST Killer toxin-resistance protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRE5 PE=1 SV=2 868 1358 9.0E-26
sp|P22023|KRE5_YEAST Killer toxin-resistance protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRE5 PE=1 SV=2 150 600 1.0E-10
sp|Q8T191|UGGG_DICDI Probable UDP-glucose:glycoprotein glucosyltransferase A OS=Dictyostelium discoideum GN=ggtA PE=1 SV=2 11 467 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006486 protein glycosylation Yes
GO:0003980 UDP-glucose:glycoprotein glucosyltransferase activity Yes
GO:0016758 hexosyltransferase activity No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0046527 glucosyltransferase activity No
GO:0044238 primary metabolic process No
GO:0043412 macromolecule modification No
GO:0070085 glycosylation No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0043413 macromolecule glycosylation No
GO:0016740 transferase activity No
GO:0071704 organic substance metabolic process No
GO:0019538 protein metabolic process No
GO:0035251 UDP-glucosyltransferase activity No
GO:0036211 protein modification process No
GO:0008194 UDP-glycosyltransferase activity No
GO:0016757 glycosyltransferase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4972
MTAVTAVAVPSVNVGMKAAFSAGPYLLELLETAAAENDTAYFPLLDRIASGYFVSASSDAELYSKFLDLLVSDRH
VAGPEALSTFNLALTLRSAAPRIEAHYQYYSTAVEPSVDHKCLNWVLLEGKQYCTPELDKAMREGLFTSGVTTLP
FDRTLGSGKEAVLYADPVSETFGDYHKALSTAARALDFKYRVRYRRSEANPVRSLPVSGYGVELALKRTDYIVID
DRDAAVDRSQKPLTSGAFDEGDEVANLRPLSTSELASLGLRAASFIQNSDNPFAMLVKLTQDFPRYSASVTAHNV
SEPFNAAREMVAPGGINFLWMNGVQLIERQIEPFSLVEMLRRERKLVDGFRRLGFTGKQAISLLGHSAISTAKGD
DEVLRYDWTDQPENRRAIIWLNDLENDSRYKDYPKSLMALLQRTFPGQIPQIGRNVFNIIAPVDLSTTEDVAFVS
QLVSIVRRGIPLRFGLVPLTSTAAAIAQAKVIFYLMENHTIETLFAYIDGLSESSASNVNDKLFTDVVAGADSLT
NVEKLSLSEIIQANFSAERMKSALHWVKRLRADTAVRPLFINGVVISRDANWMQTMSMKISGDLQIIQKQFFQGS
LAEDSESSKIFLEGAISRRNPYISVESDKALRMLDVSRIYSEHGKLFGRIPVLEPYSESTKENWAVVTILADLTA
VSGRELVLAAMEFKRSNPGVRLELIHSPEDSSKAPRVNSALHAQVELLKDMESIDQLTKVVDSAEGESVDDDYAP
ALSAFLNMAKVEAGRNTIILNGRVVGPISTDEAFTADDFQLLLEYEQGHRILPVYAAIDDLGLGDKLSCAMAAAK
ATSITALSTISDLPEGIFESAPTTRSTMYDSWNVSHATIEVGDSETASIHIAGLLDPVSEKGQRWTPILQVLSEL
DGVYLKIILNPREKITELPLKRFFRYVMDAKPSFEKSGSMKALKASFESLPSEVLLTVGMDVPPAWLVAPKESVH
DLDNIKLSSVKSDIDATYELEHILIEGHSREGRGAPPRGAQLTLATEKDPMITDTIIMSNLGFFQFKANPGLYKI
KLKEGRTADVYMIESIGAQGWEATSGDEGTELALMDFQGTTLYPRLKRRPGMEEKDVLEASGSAFSGSIVSKGLK
FAEELLGTKSKSLSVQKHAEINIFSVASGHLYERMLNIMMVSVMRNTKHSVKFWFIEQFLSPSFKEFIPHMADEY
GFRYEMVTYKWPHWLRQQKEKQREIWGYKILFLDVLFPLSLDKVIFVDADQVVRTDMMDLVDLDLKGAPYGFTPM
CDSRTEMEGFRFWKQGYWSNYLRGRPYHISALYVVDLRRFREVAAGDRLRQQYHALSADPASLSNLDQDLPNHMQ
FEIPIHSLPQEWLWCETWCSDESLAKARTIDLCNNPQTKEPKLDRARRQVPEWTVYDEEIAALVRGRRAVPVDEE
VVPEHGGESSQADTNTKSRRLDGEDGRNVHTVDEL
Coding >Ophio5|4972
ATGACGGCAGTGACTGCCGTCGCCGTTCCGTCCGTCAATGTGGGCATGAAGGCGGCTTTTTCGGCTGGACCATAT
CTGCTGGAGCTTCTTGAAACTGCAGCAGCAGAAAATGATACTGCCTACTTTCCGCTTCTCGACCGAATCGCGAGC
GGATATTTCGTCTCAGCCTCGTCCGACGCCGAGTTATACAGCAAGTTCTTGGACCTTCTTGTCTCTGACAGGCAT
GTCGCGGGCCCCGAGGCTCTCTCAACCTTCAATCTTGCCCTGACGCTACGGTCGGCTGCTCCTCGAATTGAAGCC
CATTATCAGTACTACTCAACGGCGGTTGAGCCATCTGTTGACCACAAATGCCTGAATTGGGTTTTACTTGAAGGG
AAACAGTATTGTACGCCGGAACTGGATAAAGCCATGAGAGAAGGTCTCTTCACTTCCGGAGTGACGACTTTACCT
TTCGACCGCACTCTGGGGTCTGGCAAGGAGGCGGTTCTCTACGCCGATCCTGTATCCGAGACTTTTGGCGACTAT
CACAAAGCTCTTTCCACGGCAGCTCGCGCTCTGGACTTCAAATACCGCGTGCGTTACCGACGTAGCGAGGCGAAC
CCCGTCCGTTCCCTACCTGTCAGCGGTTACGGTGTCGAATTGGCTTTGAAAAGGACTGATTACATCGTCATTGAT
GACAGAGACGCCGCTGTTGACCGGTCGCAAAAGCCCCTCACATCCGGTGCTTTCGACGAAGGGGATGAAGTTGCG
AACCTACGGCCTTTGTCCACTTCTGAGCTTGCCTCGCTTGGCCTGAGGGCGGCCTCCTTCATTCAAAATAGCGAC
AACCCTTTCGCAATGCTTGTGAAGCTGACCCAAGATTTCCCGCGATATTCGGCGTCGGTCACCGCTCACAACGTC
TCCGAACCCTTCAACGCCGCACGTGAGATGGTTGCGCCGGGCGGAATCAATTTCTTGTGGATGAACGGTGTCCAG
CTGATTGAGCGTCAGATTGAGCCCTTCTCCCTGGTAGAGATGCTTCGCCGTGAAAGAAAACTCGTTGACGGTTTT
CGGCGTCTTGGTTTTACGGGGAAGCAAGCTATCTCGCTCCTAGGGCACTCGGCGATCTCGACAGCTAAGGGAGAC
GATGAAGTTTTGAGGTACGACTGGACGGATCAGCCAGAGAACAGGCGAGCAATCATCTGGCTTAATGATCTTGAA
AACGATTCTCGCTACAAAGACTACCCCAAGAGCTTGATGGCGCTCTTGCAACGAACCTTTCCTGGACAGATACCT
CAAATCGGTCGCAACGTTTTCAATATCATTGCTCCCGTTGATCTGTCGACTACCGAAGACGTTGCTTTCGTGTCT
CAACTAGTCTCCATCGTAAGACGCGGCATTCCTCTACGGTTCGGCTTAGTTCCTTTAACCTCGACCGCCGCCGCC
ATTGCTCAAGCAAAGGTGATCTTTTATCTGATGGAAAATCACACCATCGAAACCCTGTTTGCCTACATTGACGGC
CTGAGCGAAAGCTCAGCGAGCAACGTCAACGACAAGCTGTTCACCGACGTCGTTGCAGGCGCAGATTCACTCACC
AATGTTGAAAAGCTGTCATTGTCAGAGATTATTCAGGCTAATTTCTCGGCAGAACGGATGAAGTCCGCTCTCCAC
TGGGTAAAGAGGCTCAGGGCAGACACGGCCGTTCGACCTCTCTTCATAAATGGCGTCGTCATCTCCCGCGACGCA
AATTGGATGCAAACGATGAGCATGAAGATCAGCGGAGACCTCCAAATTATCCAAAAACAATTTTTTCAGGGAAGT
TTGGCTGAAGACTCCGAGAGCTCGAAGATATTTCTGGAAGGCGCCATCTCGAGAAGGAATCCATACATCTCGGTC
GAAAGCGACAAGGCTCTTCGGATGCTAGACGTCAGTCGAATCTACAGTGAGCATGGCAAGCTCTTCGGAAGGATA
CCGGTTCTAGAGCCATATTCGGAATCAACGAAGGAAAACTGGGCAGTCGTGACGATCCTGGCCGACTTGACAGCT
GTCAGTGGTCGCGAGCTAGTATTGGCTGCAATGGAGTTCAAGCGCAGCAACCCCGGTGTGCGGCTAGAGCTCATC
CACAGTCCCGAAGACTCGTCAAAGGCTCCTCGGGTGAACTCGGCTCTTCACGCCCAGGTTGAGCTTCTCAAGGAC
ATGGAGAGCATCGACCAGCTTACCAAAGTCGTGGACTCAGCTGAGGGCGAAAGTGTCGATGACGATTACGCTCCG
GCTCTGTCGGCATTTCTGAACATGGCCAAAGTCGAAGCAGGCAGAAACACCATTATACTGAATGGGCGAGTCGTT
GGACCCATTTCAACCGATGAGGCCTTCACAGCCGACGACTTCCAGCTACTATTGGAATATGAACAAGGCCACCGC
ATACTCCCCGTGTACGCAGCAATCGATGATCTCGGACTGGGAGACAAGCTCTCATGCGCCATGGCCGCAGCCAAA
GCCACTTCCATCACGGCCCTCTCCACGATATCAGATCTCCCAGAAGGGATTTTCGAATCGGCGCCGACCACGCGC
TCGACCATGTACGATTCCTGGAATGTCAGCCACGCTACCATCGAGGTCGGAGATTCCGAGACTGCCAGCATTCAC
ATTGCCGGACTTTTGGACCCCGTCAGTGAAAAGGGGCAAAGATGGACTCCTATCTTGCAGGTGTTGTCGGAATTA
GACGGCGTATACCTGAAGATCATACTCAACCCCCGCGAGAAGATCACTGAGCTTCCGTTAAAGCGTTTCTTCCGA
TACGTCATGGACGCAAAGCCTTCTTTCGAGAAGAGTGGGAGCATGAAGGCTCTAAAAGCAAGCTTTGAGAGTCTG
CCATCCGAGGTGCTTCTGACGGTCGGCATGGACGTTCCCCCAGCGTGGTTGGTGGCTCCGAAGGAGTCTGTCCAC
GATCTGGATAACATCAAGTTGAGCTCCGTCAAGTCTGATATTGATGCCACGTACGAATTGGAGCATATTCTCATC
GAGGGACACTCGCGAGAAGGCCGAGGGGCGCCGCCCAGAGGTGCGCAACTGACGCTGGCCACGGAAAAAGACCCG
ATGATCACGGACACAATAATCATGTCGAACCTAGGCTTCTTCCAATTCAAGGCAAACCCGGGTCTCTACAAGATC
AAGCTGAAAGAGGGACGCACGGCAGACGTATACATGATTGAGAGTATTGGAGCCCAGGGATGGGAGGCCACATCA
GGCGATGAGGGAACCGAGCTGGCTTTGATGGATTTCCAGGGTACGACGCTGTACCCGCGCCTCAAACGGCGACCC
GGGATGGAGGAGAAGGACGTGCTGGAGGCATCCGGCAGCGCCTTCTCCGGCAGCATTGTCTCCAAGGGCCTGAAG
TTCGCCGAAGAGCTACTGGGGACCAAGTCCAAGTCGCTGTCTGTGCAGAAGCACGCGGAGATCAACATCTTCTCG
GTGGCCAGCGGACACTTGTATGAGCGCATGCTTAACATCATGATGGTATCGGTGATGCGGAACACGAAGCACAGC
GTCAAGTTCTGGTTCATTGAGCAGTTCCTCTCGCCGTCGTTCAAGGAGTTCATCCCGCACATGGCGGACGAGTAC
GGCTTCAGGTACGAGATGGTGACTTACAAATGGCCGCATTGGCTGCGACAGCAGAAGGAGAAGCAGCGCGAGATC
TGGGGATACAAGATCCTGTTCCTTGACGTGCTCTTCCCGCTGTCGCTTGACAAGGTCATCTTCGTCGACGCGGAC
CAGGTTGTGCGGACGGACATGATGGACCTGGTCGACCTGGATTTGAAGGGCGCGCCGTATGGCTTCACGCCCATG
TGCGACTCTCGGACGGAGATGGAGGGATTCCGGTTCTGGAAGCAAGGCTACTGGTCCAACTACCTCCGAGGCCGG
CCCTATCACATCTCGGCTCTCTATGTTGTCGATCTGCGTCGGTTCCGAGAGGTCGCAGCCGGCGATCGACTGCGG
CAGCAGTACCATGCGTTGAGCGCGGACCCAGCCAGCCTGTCCAACCTGGATCAAGATCTTCCCAATCACATGCAG
TTCGAGATTCCCATCCACAGCCTGCCGCAGGAGTGGCTGTGGTGCGAGACGTGGTGCAGCGATGAGAGCCTCGCA
AAGGCACGCACCATCGACCTCTGCAACAATCCGCAGACCAAGGAGCCTAAGCTTGACCGCGCCAGAAGGCAAGTC
CCCGAGTGGACCGTCTATGACGAGGAGATTGCCGCCCTGGTCAGGGGGCGGCGGGCCGTACCAGTCGACGAGGAA
GTCGTGCCAGAGCACGGCGGGGAGTCGAGCCAAGCCGACACAAACACCAAGAGCCGCAGGCTGGACGGAGAAGAC
GGAAGGAATGTCCATACCGTAGACGAGCTG
Transcript >Ophio5|4972
ATGACGGCAGTGACTGCCGTCGCCGTTCCGTCCGTCAATGTGGGCATGAAGGCGGCTTTTTCGGCTGGACCATAT
CTGCTGGAGCTTCTTGAAACTGCAGCAGCAGAAAATGATACTGCCTACTTTCCGCTTCTCGACCGAATCGCGAGC
GGATATTTCGTCTCAGCCTCGTCCGACGCCGAGTTATACAGCAAGTTCTTGGACCTTCTTGTCTCTGACAGGCAT
GTCGCGGGCCCCGAGGCTCTCTCAACCTTCAATCTTGCCCTGACGCTACGGTCGGCTGCTCCTCGAATTGAAGCC
CATTATCAGTACTACTCAACGGCGGTTGAGCCATCTGTTGACCACAAATGCCTGAATTGGGTTTTACTTGAAGGG
AAACAGTATTGTACGCCGGAACTGGATAAAGCCATGAGAGAAGGTCTCTTCACTTCCGGAGTGACGACTTTACCT
TTCGACCGCACTCTGGGGTCTGGCAAGGAGGCGGTTCTCTACGCCGATCCTGTATCCGAGACTTTTGGCGACTAT
CACAAAGCTCTTTCCACGGCAGCTCGCGCTCTGGACTTCAAATACCGCGTGCGTTACCGACGTAGCGAGGCGAAC
CCCGTCCGTTCCCTACCTGTCAGCGGTTACGGTGTCGAATTGGCTTTGAAAAGGACTGATTACATCGTCATTGAT
GACAGAGACGCCGCTGTTGACCGGTCGCAAAAGCCCCTCACATCCGGTGCTTTCGACGAAGGGGATGAAGTTGCG
AACCTACGGCCTTTGTCCACTTCTGAGCTTGCCTCGCTTGGCCTGAGGGCGGCCTCCTTCATTCAAAATAGCGAC
AACCCTTTCGCAATGCTTGTGAAGCTGACCCAAGATTTCCCGCGATATTCGGCGTCGGTCACCGCTCACAACGTC
TCCGAACCCTTCAACGCCGCACGTGAGATGGTTGCGCCGGGCGGAATCAATTTCTTGTGGATGAACGGTGTCCAG
CTGATTGAGCGTCAGATTGAGCCCTTCTCCCTGGTAGAGATGCTTCGCCGTGAAAGAAAACTCGTTGACGGTTTT
CGGCGTCTTGGTTTTACGGGGAAGCAAGCTATCTCGCTCCTAGGGCACTCGGCGATCTCGACAGCTAAGGGAGAC
GATGAAGTTTTGAGGTACGACTGGACGGATCAGCCAGAGAACAGGCGAGCAATCATCTGGCTTAATGATCTTGAA
AACGATTCTCGCTACAAAGACTACCCCAAGAGCTTGATGGCGCTCTTGCAACGAACCTTTCCTGGACAGATACCT
CAAATCGGTCGCAACGTTTTCAATATCATTGCTCCCGTTGATCTGTCGACTACCGAAGACGTTGCTTTCGTGTCT
CAACTAGTCTCCATCGTAAGACGCGGCATTCCTCTACGGTTCGGCTTAGTTCCTTTAACCTCGACCGCCGCCGCC
ATTGCTCAAGCAAAGGTGATCTTTTATCTGATGGAAAATCACACCATCGAAACCCTGTTTGCCTACATTGACGGC
CTGAGCGAAAGCTCAGCGAGCAACGTCAACGACAAGCTGTTCACCGACGTCGTTGCAGGCGCAGATTCACTCACC
AATGTTGAAAAGCTGTCATTGTCAGAGATTATTCAGGCTAATTTCTCGGCAGAACGGATGAAGTCCGCTCTCCAC
TGGGTAAAGAGGCTCAGGGCAGACACGGCCGTTCGACCTCTCTTCATAAATGGCGTCGTCATCTCCCGCGACGCA
AATTGGATGCAAACGATGAGCATGAAGATCAGCGGAGACCTCCAAATTATCCAAAAACAATTTTTTCAGGGAAGT
TTGGCTGAAGACTCCGAGAGCTCGAAGATATTTCTGGAAGGCGCCATCTCGAGAAGGAATCCATACATCTCGGTC
GAAAGCGACAAGGCTCTTCGGATGCTAGACGTCAGTCGAATCTACAGTGAGCATGGCAAGCTCTTCGGAAGGATA
CCGGTTCTAGAGCCATATTCGGAATCAACGAAGGAAAACTGGGCAGTCGTGACGATCCTGGCCGACTTGACAGCT
GTCAGTGGTCGCGAGCTAGTATTGGCTGCAATGGAGTTCAAGCGCAGCAACCCCGGTGTGCGGCTAGAGCTCATC
CACAGTCCCGAAGACTCGTCAAAGGCTCCTCGGGTGAACTCGGCTCTTCACGCCCAGGTTGAGCTTCTCAAGGAC
ATGGAGAGCATCGACCAGCTTACCAAAGTCGTGGACTCAGCTGAGGGCGAAAGTGTCGATGACGATTACGCTCCG
GCTCTGTCGGCATTTCTGAACATGGCCAAAGTCGAAGCAGGCAGAAACACCATTATACTGAATGGGCGAGTCGTT
GGACCCATTTCAACCGATGAGGCCTTCACAGCCGACGACTTCCAGCTACTATTGGAATATGAACAAGGCCACCGC
ATACTCCCCGTGTACGCAGCAATCGATGATCTCGGACTGGGAGACAAGCTCTCATGCGCCATGGCCGCAGCCAAA
GCCACTTCCATCACGGCCCTCTCCACGATATCAGATCTCCCAGAAGGGATTTTCGAATCGGCGCCGACCACGCGC
TCGACCATGTACGATTCCTGGAATGTCAGCCACGCTACCATCGAGGTCGGAGATTCCGAGACTGCCAGCATTCAC
ATTGCCGGACTTTTGGACCCCGTCAGTGAAAAGGGGCAAAGATGGACTCCTATCTTGCAGGTGTTGTCGGAATTA
GACGGCGTATACCTGAAGATCATACTCAACCCCCGCGAGAAGATCACTGAGCTTCCGTTAAAGCGTTTCTTCCGA
TACGTCATGGACGCAAAGCCTTCTTTCGAGAAGAGTGGGAGCATGAAGGCTCTAAAAGCAAGCTTTGAGAGTCTG
CCATCCGAGGTGCTTCTGACGGTCGGCATGGACGTTCCCCCAGCGTGGTTGGTGGCTCCGAAGGAGTCTGTCCAC
GATCTGGATAACATCAAGTTGAGCTCCGTCAAGTCTGATATTGATGCCACGTACGAATTGGAGCATATTCTCATC
GAGGGACACTCGCGAGAAGGCCGAGGGGCGCCGCCCAGAGGTGCGCAACTGACGCTGGCCACGGAAAAAGACCCG
ATGATCACGGACACAATAATCATGTCGAACCTAGGCTTCTTCCAATTCAAGGCAAACCCGGGTCTCTACAAGATC
AAGCTGAAAGAGGGACGCACGGCAGACGTATACATGATTGAGAGTATTGGAGCCCAGGGATGGGAGGCCACATCA
GGCGATGAGGGAACCGAGCTGGCTTTGATGGATTTCCAGGGTACGACGCTGTACCCGCGCCTCAAACGGCGACCC
GGGATGGAGGAGAAGGACGTGCTGGAGGCATCCGGCAGCGCCTTCTCCGGCAGCATTGTCTCCAAGGGCCTGAAG
TTCGCCGAAGAGCTACTGGGGACCAAGTCCAAGTCGCTGTCTGTGCAGAAGCACGCGGAGATCAACATCTTCTCG
GTGGCCAGCGGACACTTGTATGAGCGCATGCTTAACATCATGATGGTATCGGTGATGCGGAACACGAAGCACAGC
GTCAAGTTCTGGTTCATTGAGCAGTTCCTCTCGCCGTCGTTCAAGGAGTTCATCCCGCACATGGCGGACGAGTAC
GGCTTCAGGTACGAGATGGTGACTTACAAATGGCCGCATTGGCTGCGACAGCAGAAGGAGAAGCAGCGCGAGATC
TGGGGATACAAGATCCTGTTCCTTGACGTGCTCTTCCCGCTGTCGCTTGACAAGGTCATCTTCGTCGACGCGGAC
CAGGTTGTGCGGACGGACATGATGGACCTGGTCGACCTGGATTTGAAGGGCGCGCCGTATGGCTTCACGCCCATG
TGCGACTCTCGGACGGAGATGGAGGGATTCCGGTTCTGGAAGCAAGGCTACTGGTCCAACTACCTCCGAGGCCGG
CCCTATCACATCTCGGCTCTCTATGTTGTCGATCTGCGTCGGTTCCGAGAGGTCGCAGCCGGCGATCGACTGCGG
CAGCAGTACCATGCGTTGAGCGCGGACCCAGCCAGCCTGTCCAACCTGGATCAAGATCTTCCCAATCACATGCAG
TTCGAGATTCCCATCCACAGCCTGCCGCAGGAGTGGCTGTGGTGCGAGACGTGGTGCAGCGATGAGAGCCTCGCA
AAGGCACGCACCATCGACCTCTGCAACAATCCGCAGACCAAGGAGCCTAAGCTTGACCGCGCCAGAAGGCAAGTC
CCCGAGTGGACCGTCTATGACGAGGAGATTGCCGCCCTGGTCAGGGGGCGGCGGGCCGTACCAGTCGACGAGGAA
GTCGTGCCAGAGCACGGCGGGGAGTCGAGCCAAGCCGACACAAACACCAAGAGCCGCAGGCTGGACGGAGAAGAC
GGAAGGAATGTCCATACCGTAGACGAGCTGTGA
Gene >Ophio5|4972
ATGACGGCAGTGACTGCCGTCGCCGTTCCGTCCGTCAATGTGGGCATGAAGGCGGCTTTTTCGGCTGGACCATAT
CTGCTGGAGCTTCTGTATGCCATCCCCTATGATACCCTTCTTGCCGTTCGGATGCTGAAGCGGCGCCAGTGAAAC
TGCAGCAGCAGAAAATGATACTGCCTACTTTCCGCTTCTCGACCGAATCGCGAGCGGATATTTCGTCTCAGCCTC
GTCCGACGCCGAGTTATACAGCAAGTTCTTGGACCTTCTTGTCTCTGACAGGCATGTCGCGGGCCCCGAGGCTCT
CTCAACCTTCAATCTTGCCCTGACGCTACGGTCGGCTGCTCCTCGAATTGAAGCCCATTATCAGTACTACTCAAC
GGCGGTTGAGCCATCTGTTGACCACAAATGCCTGAATTGGGTTTTACTTGAAGGGAAACAGTATTGTACGCCGGA
ACTGGATAAAGCCATGAGAGAAGGTCTCTTCACTTCGTGCGTCGATCACTATATGCTTGGTTCTGTGATGTCGTT
CTGACTCATTATCGGATGTAGCGGAGTGACGACTTTACCTTTCGACCGCACTCTGGGGTCTGGCAAGGAGGCGGT
TCTCTACGCCGATCCTGTATCCGAGACTTTTGGCGACTATCACAAAGCTCTTTCCACGGCAGCTCGCGCTCTGGA
CTTCAAATACCGCGTGCGTTACCGACGTAGCGAGGCGAACCCCGTCCGTTCCCTACCTGTCAGCGGTTACGGTGT
CGAATTGGCTTTGAAAAGGACTGATTACATCGTCATTGATGACAGAGACGCCGCTGTTGACCGGTCGCAAAAGCC
CCTCACATCCGGTGCTTTCGACGAAGGGGATGAAGTTGCGAACCTACGGCCTTTGTCCACTTCTGAGCTTGCCTC
GCTTGGCCTGAGGGCGGCCTCCTTCATTCAAAATAGCGACAACCCTTTCGCAATGCTTGTGAAGCTGACCCAAGA
TTTCCCGCGATATTCGGCGTCGGTCACCGCTCACAACGTCTCCGAACCCTTCAACGCCGCACGTGAGATGGTTGC
GCCGGGCGGAATCAATTTCTTGTGGATGAACGGTGTCCAGCTGATTGAGCGTCAGATTGAGCCCTTCTCCCTGGT
AGAGATGCTTCGCCGTGAAAGAAAACTCGTTGACGGTTTTCGGCGTCTTGGTTTTACGGGGAAGCAAGCTATCTC
GCTCCTAGGGCACTCGGCGATCTCGACAGCTAAGGGAGACGATGAAGTTTTGAGGTACGACTGGACGGATCAGCC
AGAGAACAGGCGAGCAATCATCTGGCTTAATGATCTTGAAAACGATTCTCGCTACAAAGACTACCCCAAGAGCTT
GATGGCGGTAGGTTTGCTACATGTTAATTACGAATCGTGCTTTGACTAATCGATGAGGCAGCTCTTGCAACGAAC
CTTTCCTGGACAGATACCTCAAATCGGTCGCAACGTTTTCAATATCATTGCTCCCGTTGATCTGTCGACTACCGA
AGACGTTGCTTTCGTGTCTCAACTAGTCTCCATCGTAAGACGCGGCATTCCTCTACGGTTCGGCTTAGTTCCTTT
AACCTCGACCGCCGCCGCCATTGCTCAAGCAAAGGTGATCTTTTATCTGATGGAAAATCACACCATCGAAACCCT
GTTTGCCTACATTGACGGCCTGAGCGAAAGCTCAGCGAGCAACGTCAACGACAAGCTGTTCACCGACGTCGTTGC
AGGCGCAGATTCACTCACCAATGTTGAAAAGCTGTCATTGTCAGAGATTATTCAGGCTAATTTCTCGGCAGAACG
GATGAAGTCCGCTCTCCACTGGGTAAAGAGGCTCAGGGCAGACACGGCCGTTCGACCTCTCTTCATAAATGGCGT
CGTCATCTCCCGCGACGCAAATTGGATGCAAACGATGAGCATGAAGATCAGCGGAGACCTCCAAATTATCCAAAA
ACAATTTTTTCAGGGAAGTTTGGCTGAAGACTCCGAGAGCTCGAAGATATTTCTGGAAGGCGCCATCTCGAGAAG
GAATCCATACATCTCGGTCGAAAGCGACAAGGCTCTTCGGATGCTAGACGTCAGTCGAATCTACAGTGAGCATGG
CAAGCTCTTCGGAAGGATACCGGTTCTAGAGCCATATTCGGAATCAACGAAGGAAAACTGGGCAGTCGTGACGAT
CCTGGCCGACTTGACAGCTGTCAGTGGTCGCGAGCTAGTATTGGCTGCAATGGAGTTCAAGCGCAGCAACCCCGG
TGTGCGGCTAGAGCTCATCCACAGTCCCGAAGACTCGTCAAAGGCTCCTCGGGTGAACTCGGCTCTTCACGCCCA
GGTTGAGCTTCTCAAGGACATGGAGAGCATCGACCAGCTTACCAAAGTCGTGGACTCAGCTGAGGGCGAAAGTGT
CGATGACGATTACGCTCCGGCTCTGTCGGCATTTCTGAACATGGCCAAAGTCGAAGCAGGCAGAAACACCATTAT
ACTGAATGGGCGAGTCGTTGGACCCATTTCAACCGATGAGGCCTTCACAGCCGACGACTTCCAGCTACTATTGGA
ATATGAACAAGGCCACCGCATACTCCCCGTGTACGCAGCAATCGATGATCTCGGACTGGGAGACAAGCTCTCATG
CGCCATGGCCGCAGCCAAAGCCACTTCCATCACGGCCCTCTCCACGATATCAGATCTCCCAGAAGGGATTTTCGA
ATCGGCGCCGACCACGCGCTCGACCATGTACGATTCCTGGAATGTCAGCCACGCTACCATCGAGGTCGGAGATTC
CGAGACTGCCAGCATTCACATTGCCGGACTTTTGGACCCCGTCAGTGAAAAGGGGCAAAGATGGACTCCTATCTT
GCAGGTGTTGTCGGAATTAGACGGCGTATACCTGAAGATCATACTCAACCCCCGCGAGAAGATCACTGAGCTTCC
GTTAAAGCGTTTCTTCCGATACGTCATGGACGCAAAGCCTTCTTTCGAGAAGAGTGGGAGCATGAAGGCTCTAAA
AGCAAGCTTTGAGAGTCTGCCATCCGAGGTGCTTCTGACGGTCGGCATGGACGTTCCCCCAGCGTGGTTGGTGGC
TCCGAAGGAGTCTGTCCACGATCTGGATAACATCAAGTTGAGCTCCGTCAAGTCTGATATTGATGCCACGTACGA
ATTGGAGCATATTCTCATCGAGGGACACTCGCGAGAAGGCCGAGGGGCGCCGCCCAGAGGTGCGCAACTGACGCT
GGCCACGGAAAAAGACCCGATGATCACGGACACAATAATCATGTCGAACCTAGGCTTCTTCCAATTCAAGGCAAA
CCCGGGTCTCTACAAGATCAAGCTGAAAGAGGGACGCACGGCAGACGTATACATGATTGAGAGTATTGGAGCCCA
GGGATGGGAGGCCACATCAGGCGATGAGGGAACCGAGCTGGCTTTGATGGATTTCCAGGGTACGACGCTGTACCC
GCGCCTCAAACGGCGACCCGGGATGGAGGAGAAGGACGTGCTGGAGGCATCCGGCAGCGCCTTCTCCGGCAGCAT
TGTCTCCAAGGGCCTGAAGTTCGCCGAAGAGCTACTGGGGACCAAGTCCAAGTCGCTGTCTGTGCAGAAGCACGC
GGAGATCAACATCTTCTCGGTGGCCAGCGGACACTTGTATGAGCGCATGCTTAACATCATGATGGTATCGGTGAT
GCGGAACACGAAGCACAGCGTCAAGTTCTGGTTCATTGAGCAGTTCCTCTCGCCGTCGTTCAAGGAGTTCATCCC
GCACATGGCGGACGAGTACGGCTTCAGGTACGAGATGGTGACTTACAAATGGCCGCATTGGCTGCGACAGCAGAA
GGAGAAGCAGCGCGAGATCTGGGGATACAAGATCCTGTTCCTTGACGTGCTCTTCCCGCTGTCGCTTGACAAGGT
CATCTTCGTCGACGCGGACCAGGTTGTGCGGACGGACATGATGGACCTGGTCGACCTGGATTTGAAGGGCGCGCC
GTATGGCTTCACGCCCATGTGCGACTCTCGGACGGAGATGGAGGGATTCCGGTTCTGGAAGCAAGGCTACTGGTC
CAACTACCTCCGAGGCCGGCCCTATCACATCTCGGCTCTCTATGTTGTCGATCTGCGTCGGTTCCGAGAGGTCGC
AGCCGGCGATCGACTGCGGCAGCAGTACCATGCGTTGAGCGCGGACCCAGCCAGCCTGTCCAACCTGGATCAAGA
TCTTCCCAATCACATGCAGTTCGAGATTCCCATCCACAGCCTGCCGCAGGAGTGGCTGTGGTGCGAGACGTGGTG
CAGCGATGAGAGCCTCGCAAAGGCACGCACCATCGACCTCTGCAACAATCCGCAGACCAAGGAGCCTAAGCTTGA
CCGCGCCAGAAGGCAAGTCCCCGAGTGGACCGTCTATGACGAGGAGATTGCCGCCCTGGTCAGGGGGCGGCGGGC
CGTACCAGTCGACGAGGAAGTCGTGCCAGAGCACGGCGGGGAGTCGAGCCAAGCCGACACAAACACCAAGAGCCG
CAGGCTGGACGGAGAAGACGGAAGGAATGTCCATACCGTAGACGAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail