Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4969
Gene name
Locationscaffold_4:59830..62522
Strand-
Gene length (bp)2692
Transcript length (bp)2502
Coding sequence length (bp)2499
Protein length (aa) 833

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 2.9E+01 202 237
PF08238 Sel1 Sel1 repeat 2.4E+02 239 263
PF08238 Sel1 Sel1 repeat 6.8E-01 270 296
PF08238 Sel1 Sel1 repeat 2.3E+02 332 352
PF08238 Sel1 Sel1 repeat 1.8E+02 356 389
PF08238 Sel1 Sel1 repeat 7.3E-02 392 426
PF08238 Sel1 Sel1 repeat 1.0E-04 432 464

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94614|CHR4_SCHPO Chitin synthase regulatory factor 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr4 PE=1 SV=4 62 474 4.0E-46
sp|Q09897|CHR3_SCHPO Chitin synthase regulatory factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr3 PE=1 SV=1 201 482 1.0E-30
sp|P34226|SKT5_YEAST Protein SKT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKT5 PE=1 SV=1 161 490 2.0E-28
sp|Q07622|ACK1_YEAST Activator of C kinase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACK1 PE=1 SV=1 146 475 1.0E-22
sp|O94486|CHR2_SCHPO Chitin synthase regulatory factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr2 PE=3 SV=1 200 424 4.0E-19

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6232 0.2412 0.0335 0.4824 0.3012 0.0122 0.1633 0.2587 0.2285 0.1574

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5790
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1756
Ophiocordyceps australis map64 (Brazil) OphauB2|4891
Ophiocordyceps camponoti-floridani Ophcf2|01769
Ophiocordyceps camponoti-rufipedis Ophun1|1006
Ophiocordyceps kimflemingae Ophio5|4969 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9772

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4969
MPQLSATFVPSGQDDYYLPEVVAPSPQRVTPQIPQTMQDDLQRLELGDGQSSEGASRRGRDSPSSTRTDSRLGRA
PESRSTSAADADADASLYQNSPKLDSMDADAPSFSPFPRVTGDNIPPADDVKEGILWNARKHVLHSQNVSMQMSW
ARDALVWVDIAADAAARESPEKARPATPRIEHELREDAMNIVNYLARQEYPDALYVRSKWLEFGKFGNRVDKREA
YNGYKRAADLGHARSEYRLGMLFEQSNDMSKAKEHYYKGMSLKDSASLYRMGMMSLLGQHGESKDYPRGLERIQA
AADSSDEDAPQGSYVYGMLVGRDLPDISIPDGLLPYNLETAKMYVEKAAYLGFAKAQLKVGQAYELCQLGCEFHP
SYSLHYYGLAARQGLPEAALGVSRWFLFGYEGVFKKNEELAFRYAQEAAMAKLPTGEFAMGYYYEIGIHVSKSIA
DARKWYQLAAEHGNRDAQNRLDSLSQDKSLSKKDHETTTLTRIKSQHGSQRGKRPERFKQPHQMPTLNESGSSPT
LDNEARKPSIAAAAVTDSPRMSPQPSPGIRPTFVSESASFPDPSRASVVGADRQSAFNIRPDVARPRSAAPYPAD
DQPMPNRSRSTAPYPEDDVASGHNLHHNLGPQSSYADRPISAFGGKGPATGPRPMPLSHSVGSLQPLPTPSSQGR
IVSAGYNRPGPGGYRHPSPGPANAGGRSYPSDNSQGRSSSTQPYSSGNRLQKQIDTRVSGHGQERLSRVPGATGR
PERLGSAPPQDPQRPPRATPSPGQASSRPGMGRIGSAQGGPVLSVSGSQSSTGSSSSKPNKGPATFEDMGIPQGK
QEGDCVVM
Coding >Ophio5|4969
ATGCCTCAGCTCAGTGCCACGTTCGTCCCAAGCGGCCAGGATGATTACTATTTGCCCGAGGTCGTCGCGCCCTCG
CCCCAGAGGGTGACTCCTCAAATACCCCAGACCATGCAGGACGATCTCCAGCGCCTCGAGCTCGGCGACGGTCAA
TCTTCCGAGGGCGCGTCTCGTCGCGGCCGGGATTCTCCATCGTCAACAAGGACCGACTCGAGGCTTGGAAGAGCC
CCTGAGTCGCGATCCACCTCCGCGGCCGACGCCGACGCCGACGCCAGCCTCTACCAAAACAGCCCAAAGCTCGAT
AGCATGGACGCCGACGCACCCTCCTTCTCCCCTTTCCCCAGGGTCACGGGCGACAATATTCCTCCGGCCGACGAC
GTCAAGGAGGGCATCTTGTGGAATGCACGCAAGCACGTGCTGCACTCCCAGAATGTCTCCATGCAGATGAGCTGG
GCTCGCGATGCGCTCGTCTGGGTTGACATCGCCGCCGACGCCGCCGCTCGCGAGTCGCCCGAGAAGGCCCGCCCG
GCAACTCCTCGAATCGAGCACGAGCTCCGCGAGGACGCCATGAACATTGTCAATTACCTGGCGCGTCAGGAGTAT
CCAGACGCGCTATATGTGCGGTCTAAGTGGCTCGAATTCGGTAAATTCGGTAATCGAGTCGACAAGCGCGAGGCC
TACAACGGCTACAAACGGGCCGCCGATCTGGGCCACGCCCGCTCAGAGTACCGCTTGGGCATGCTGTTCGAGCAG
TCCAACGACATGTCCAAGGCCAAGGAGCACTATTACAAGGGCATGAGCTTGAAGGACTCGGCATCCCTTTACCGC
ATGGGCATGATGAGCCTTCTCGGCCAACACGGCGAATCCAAGGACTATCCTCGAGGGCTGGAGCGCATCCAGGCG
GCGGCCGACAGTTCTGACGAGGACGCACCACAAGGCTCCTACGTCTACGGCATGCTGGTCGGCAGAGACCTTCCT
GACATATCCATCCCGGACGGCCTCCTGCCCTACAACCTGGAGACGGCCAAGATGTATGTCGAAAAGGCCGCATAC
CTCGGCTTCGCCAAGGCTCAGCTTAAAGTGGGCCAAGCGTACGAGCTCTGCCAGCTCGGCTGCGAGTTTCATCCG
TCCTACTCCCTTCATTACTATGGCCTAGCCGCCAGGCAGGGCCTTCCGGAGGCGGCTCTAGGTGTCAGCCGTTGG
TTCCTCTTTGGATACGAGGGCGTCTTCAAGAAAAATGAGGAGCTCGCCTTCCGGTACGCGCAGGAGGCGGCCATG
GCGAAGCTGCCCACCGGGGAATTCGCCATGGGGTACTACTATGAGATTGGCATCCACGTCAGCAAGAGCATCGCC
GACGCGCGAAAATGGTATCAGCTTGCAGCTGAGCACGGCAACAGAGACGCGCAAAATCGCCTAGACTCGCTAAGC
CAAGACAAAAGCCTGTCGAAGAAGGACCACGAGACGACAACGCTGACGCGCATCAAGTCGCAACATGGTTCGCAA
CGGGGGAAGCGTCCCGAGCGTTTCAAGCAGCCCCACCAAATGCCAACGTTGAACGAGAGCGGCTCGTCGCCGACG
CTTGACAACGAGGCGCGGAAGCCGTCAATAGCGGCGGCGGCAGTAACCGACTCCCCCCGTATGTCGCCACAACCG
TCTCCGGGCATCAGGCCTACCTTTGTATCCGAGAGCGCGTCGTTTCCAGATCCGTCGAGGGCTTCCGTGGTGGGC
GCCGACCGACAGTCGGCCTTTAACATCAGGCCAGATGTTGCGCGCCCGCGTTCCGCGGCTCCCTACCCGGCGGAC
GACCAGCCGATGCCGAACCGATCGCGATCCACGGCGCCTTATCCAGAAGATGATGTCGCCAGTGGGCACAACTTA
CACCATAACCTGGGGCCGCAGTCGTCTTACGCGGATCGGCCCATCAGCGCTTTCGGCGGCAAGGGTCCTGCCACG
GGCCCGCGACCCATGCCGTTGTCGCACAGCGTAGGCAGTCTCCAACCGCTGCCGACGCCTTCGTCCCAGGGGAGG
ATCGTCTCTGCCGGGTACAACCGTCCCGGTCCGGGAGGCTATCGACATCCAAGCCCTGGACCGGCCAACGCTGGC
GGTCGCTCATATCCGAGCGACAACTCACAAGGGCGGTCGTCAAGCACGCAGCCGTACTCTAGTGGCAACAGATTA
CAGAAGCAAATCGATACCCGCGTGTCTGGCCACGGCCAGGAGCGATTGTCCAGAGTTCCCGGCGCCACGGGTAGG
CCAGAGCGGCTCGGCTCGGCGCCTCCACAGGATCCCCAGAGGCCACCTCGGGCGACTCCCAGCCCGGGCCAGGCG
TCTTCGAGGCCGGGCATGGGAAGGATTGGCAGTGCGCAGGGTGGCCCAGTCCTTTCCGTGTCGGGCTCTCAGAGC
TCGACGGGCTCGTCGTCGTCTAAGCCAAACAAGGGCCCGGCGACGTTTGAGGACATGGGAATCCCGCAGGGGAAG
CAAGAAGGCGATTGTGTTGTCATG
Transcript >Ophio5|4969
ATGCCTCAGCTCAGTGCCACGTTCGTCCCAAGCGGCCAGGATGATTACTATTTGCCCGAGGTCGTCGCGCCCTCG
CCCCAGAGGGTGACTCCTCAAATACCCCAGACCATGCAGGACGATCTCCAGCGCCTCGAGCTCGGCGACGGTCAA
TCTTCCGAGGGCGCGTCTCGTCGCGGCCGGGATTCTCCATCGTCAACAAGGACCGACTCGAGGCTTGGAAGAGCC
CCTGAGTCGCGATCCACCTCCGCGGCCGACGCCGACGCCGACGCCAGCCTCTACCAAAACAGCCCAAAGCTCGAT
AGCATGGACGCCGACGCACCCTCCTTCTCCCCTTTCCCCAGGGTCACGGGCGACAATATTCCTCCGGCCGACGAC
GTCAAGGAGGGCATCTTGTGGAATGCACGCAAGCACGTGCTGCACTCCCAGAATGTCTCCATGCAGATGAGCTGG
GCTCGCGATGCGCTCGTCTGGGTTGACATCGCCGCCGACGCCGCCGCTCGCGAGTCGCCCGAGAAGGCCCGCCCG
GCAACTCCTCGAATCGAGCACGAGCTCCGCGAGGACGCCATGAACATTGTCAATTACCTGGCGCGTCAGGAGTAT
CCAGACGCGCTATATGTGCGGTCTAAGTGGCTCGAATTCGGTAAATTCGGTAATCGAGTCGACAAGCGCGAGGCC
TACAACGGCTACAAACGGGCCGCCGATCTGGGCCACGCCCGCTCAGAGTACCGCTTGGGCATGCTGTTCGAGCAG
TCCAACGACATGTCCAAGGCCAAGGAGCACTATTACAAGGGCATGAGCTTGAAGGACTCGGCATCCCTTTACCGC
ATGGGCATGATGAGCCTTCTCGGCCAACACGGCGAATCCAAGGACTATCCTCGAGGGCTGGAGCGCATCCAGGCG
GCGGCCGACAGTTCTGACGAGGACGCACCACAAGGCTCCTACGTCTACGGCATGCTGGTCGGCAGAGACCTTCCT
GACATATCCATCCCGGACGGCCTCCTGCCCTACAACCTGGAGACGGCCAAGATGTATGTCGAAAAGGCCGCATAC
CTCGGCTTCGCCAAGGCTCAGCTTAAAGTGGGCCAAGCGTACGAGCTCTGCCAGCTCGGCTGCGAGTTTCATCCG
TCCTACTCCCTTCATTACTATGGCCTAGCCGCCAGGCAGGGCCTTCCGGAGGCGGCTCTAGGTGTCAGCCGTTGG
TTCCTCTTTGGATACGAGGGCGTCTTCAAGAAAAATGAGGAGCTCGCCTTCCGGTACGCGCAGGAGGCGGCCATG
GCGAAGCTGCCCACCGGGGAATTCGCCATGGGGTACTACTATGAGATTGGCATCCACGTCAGCAAGAGCATCGCC
GACGCGCGAAAATGGTATCAGCTTGCAGCTGAGCACGGCAACAGAGACGCGCAAAATCGCCTAGACTCGCTAAGC
CAAGACAAAAGCCTGTCGAAGAAGGACCACGAGACGACAACGCTGACGCGCATCAAGTCGCAACATGGTTCGCAA
CGGGGGAAGCGTCCCGAGCGTTTCAAGCAGCCCCACCAAATGCCAACGTTGAACGAGAGCGGCTCGTCGCCGACG
CTTGACAACGAGGCGCGGAAGCCGTCAATAGCGGCGGCGGCAGTAACCGACTCCCCCCGTATGTCGCCACAACCG
TCTCCGGGCATCAGGCCTACCTTTGTATCCGAGAGCGCGTCGTTTCCAGATCCGTCGAGGGCTTCCGTGGTGGGC
GCCGACCGACAGTCGGCCTTTAACATCAGGCCAGATGTTGCGCGCCCGCGTTCCGCGGCTCCCTACCCGGCGGAC
GACCAGCCGATGCCGAACCGATCGCGATCCACGGCGCCTTATCCAGAAGATGATGTCGCCAGTGGGCACAACTTA
CACCATAACCTGGGGCCGCAGTCGTCTTACGCGGATCGGCCCATCAGCGCTTTCGGCGGCAAGGGTCCTGCCACG
GGCCCGCGACCCATGCCGTTGTCGCACAGCGTAGGCAGTCTCCAACCGCTGCCGACGCCTTCGTCCCAGGGGAGG
ATCGTCTCTGCCGGGTACAACCGTCCCGGTCCGGGAGGCTATCGACATCCAAGCCCTGGACCGGCCAACGCTGGC
GGTCGCTCATATCCGAGCGACAACTCACAAGGGCGGTCGTCAAGCACGCAGCCGTACTCTAGTGGCAACAGATTA
CAGAAGCAAATCGATACCCGCGTGTCTGGCCACGGCCAGGAGCGATTGTCCAGAGTTCCCGGCGCCACGGGTAGG
CCAGAGCGGCTCGGCTCGGCGCCTCCACAGGATCCCCAGAGGCCACCTCGGGCGACTCCCAGCCCGGGCCAGGCG
TCTTCGAGGCCGGGCATGGGAAGGATTGGCAGTGCGCAGGGTGGCCCAGTCCTTTCCGTGTCGGGCTCTCAGAGC
TCGACGGGCTCGTCGTCGTCTAAGCCAAACAAGGGCCCGGCGACGTTTGAGGACATGGGAATCCCGCAGGGGAAG
CAAGAAGGCGATTGTGTTGTCATGTGA
Gene >Ophio5|4969
ATGCCTCAGCTCAGTGCCACGTTCGTCCCAAGCGGCCAGGATGATTACTATTTGCCCGAGGTCGTCGCGCCCTCG
CCCCAGAGGTACGTGAGACTCAGGCTCCCCGGAGACTGCCACCTCTTTCTTTTTCCACGTGCAACATTCCGATCC
GCGCGTTGGTGCCTGGTACGGCTCCCTCGGGTGGGGCCTGCGCTGATGACCTTTCAATTTCCAGGGTGACTCCTC
AAATACCCCAGACCATGCAGGACGATCTCCAGCGCCTCGAGCTCGGCGACGGTCAATCTTCCGAGGGCGCGTCTC
GTCGCGGCCGGGATTCTCCATCGTCAACAAGGACCGACTCGAGGCTTGGAAGAGCCCCTGAGTCGCGATCCACCT
CCGCGGCCGACGCCGACGCCGACGCCAGCCTCTACCAAAACAGCCCAAAGCTCGATAGCATGGACGCCGACGCAC
CCTCCTTCTCCCCTTTCCCCAGGGTCACGGGCGACAATATTCCTCCGGCCGACGACGTCAAGGAGGGCATCTTGT
GGAATGCACGCAAGCACGTGCTGCACTCCCAGAATGTCTCCATGCAGATGAGCTGGGCTCGCGATGCGCTCGTCT
GGGTTGACATCGCCGCCGACGCCGCCGCTCGCGAGTCGCCCGAGAAGGCCCGCCCGGCAACTCCTCGAATCGAGC
ACGAGCTCCGCGAGGACGCCATGAACATTGTCAATTACCTGGCGCGTCAGGAGTATCCAGACGCGCTATATGTGC
GGTCTAAGTGGCTCGAATTCGGTAAATTCGGTAATCGAGTCGACAAGCGCGAGGCCTACAACGGCTACAAACGGG
CCGCCGATCTGGGCCACGCCCGCTCAGAGTACCGCTTGGGCATGCTGTTCGAGCAGTCCAACGACATGTCCAAGG
CCAAGGAGCACTATTACAAGGGCATGAGCTTGAAGGACTCGGCATCCCTTTACCGCATGGGCATGATGAGCCTTC
TCGGCCAACACGGCGAATCCAAGGACTATCCTCGAGGGCTGGAGCGCATCCAGGCGGCGGCCGACAGTTCTGACG
AGGACGCACCACAAGGCTCCTACGTCTACGGCATGCTGGTCGGCAGAGACCTTCCTGACATATCCATCCCGGACG
GCCTCCTGCCCTACAACCTGGAGACGGCCAAGATGTATGTCGAAAAGGCCGCATACCTCGGCTTCGCCAAGGCTC
AGCTTAAAGTGGGCCAAGCGTACGAGCTCTGCCAGCTCGGCTGCGAGTTTCATCCGTCCTACTCCCTTCATTACT
ATGGCCTAGCCGCCAGGCAGGGCCTTCCGGAGGCGGCTCTAGGTGTCAGCCGTTGGTTCCTCTTTGGATACGAGG
GCGTCTTCAAGAAAAATGAGGAGCTCGCCTTCCGGTACGCGCAGGAGGCGGCCATGGCGAAGCTGCCCACCGGGG
AATTCGCCATGGGGTACTACTATGAGATTGGCATCCACGTCAGCAAGAGCATCGCCGACGCGCGAAAATGGTATC
AGCTTGCAGCTGAGCACGGCAACAGAGACGCGCAAAATCGCCTAGACTCGCTAAGCCAAGACAAAAGCCTGTCGA
AGAAGGACCACGAGACGACAACGCTGACGCGCATCAAGTCGCAACATGGTTCGCAACGGGGGAAGCGTCCCGAGC
GTTTCAAGCAGCCCCACCAAATGCCAACGTTGAACGAGAGCGGCTCGTCGCCGACGCTTGACAACGAGGCGCGGA
AGCCGTCAATAGCGGCGGCGGCAGTAACCGACTCCCCCCGTATGTCGCCACAACCGTCTCCGGGCATCAGGCCTA
CCTTTGTATCCGAGAGCGCGTCGTTTCCAGATCCGTCGAGGGCTTCCGTGGTGGGCGCCGACCGACAGTCGGCCT
TTAACATCAGGCCAGATGTTGCGCGCCCGCGTTCCGCGGCTCCCTACCCGGCGGACGACCAGCCGATGCCGAACC
GATCGCGATCCACGGCGCCTTATCCAGAAGATGATGTCGCCAGTGGGCACAACTTACACCATAACCTGGGGCCGC
AGTCGTCTTACGCGGATCGGCCCATCAGCGCTTTCGGCGGCAAGGGTCCTGCCACGGGCCCGCGACCCATGCCGT
TGTCGCACAGCGTAGGCAGTCTCCAACCGCTGCCGACGCCTTCGTCCCAGGGGAGGATCGTCTCTGCCGGGTACA
ACCGTCCCGGTCCGGGAGGCTATCGACATCCAAGCCCTGGACCGGCCAACGCTGGCGGTCGCTCATATCCGAGCG
ACAACTCACAAGGGCGGTCGTCAAGCACGCAGCCGTACTCTAGTGGCAACAGATTACAGAAGCAAATCGATACCC
GCGTGTCTGGCCACGGCCAGGAGCGATTGTCCAGAGTTCCCGGCGCCACGGGTAGGCCAGAGCGGCTCGGCTCGG
CGCCTCCACAGGATCCCCAGAGGCCACCTCGGGCGACTCCCAGCCCGGGCCAGGCGTCTTCGAGGCCGGGCATGG
GAAGGATTGGCAGTGCGCAGGGTGGCCCAGTCCTTTCCGTGTCGGGCTCTCAGAGCTCGACGGGCTCGTCGTCGT
CTAAGCCAAACAAGGGCCCGGCGACGTTTGAGGACATGGGAATCCCGCAGGGGAAGCAAGAAGGCGATTGTGTAA
GTCGCCACGGTCCATCCTTGATTGCTTCAGTAACAAGATCTGACTCGGGACCCAGGTTGTCATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail