Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4968
Gene name
Locationscaffold_4:57511..59171
Strand-
Gene length (bp)1660
Transcript length (bp)1419
Coding sequence length (bp)1416
Protein length (aa) 472

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.8E-25 38 398

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 23 471 3.0E-63
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 2 470 5.0E-60
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 19 471 1.0E-57
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 22 470 7.0E-52
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 36 470 6.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 23 471 3.0E-63
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 2 470 5.0E-60
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 19 471 1.0E-57
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 22 470 7.0E-52
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 36 470 6.0E-49
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 22 470 9.0E-31
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 6 470 2.0E-29
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 21 471 3.0E-29
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 23 322 4.0E-28
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 23 470 1.0E-27
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 20 470 3.0E-27
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 25 471 5.0E-27
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 23 342 2.0E-25
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 23 471 6.0E-22
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 23 445 8.0E-20
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 33 345 1.0E-19
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 23 272 5.0E-17
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 23 460 3.0E-15
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 39 450 6.0E-13
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 33 322 1.0E-12
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 25 436 9.0E-12
sp|P0CF20|YO163_YEAST Putative uncharacterized transporter YOL163W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL163W PE=5 SV=1 128 257 2.0E-11
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 31 279 1.0E-08
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 25 463 1.0E-07
sp|Q0K843|SAUU_CUPNH Probable sulfoacetate transporter SauU OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauU PE=2 SV=1 34 322 3.0E-07
sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.15c PE=3 SV=1 276 442 3.0E-06
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 23 281 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 92 114 22
2 124 146 22
3 159 181 22
4 191 213 22
5 262 284 22
6 294 316 22
7 323 345 22
8 350 369 19
9 382 404 22
10 414 436 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4968
MASPLVKFPRHGPTMAVDKAAAEARIRRSFDGRVLPLLCCLYVCSYLDRGNIGNAKTAGAQDALGLDSRQWTSVL
NSFYACYVLFEWTTMLWRILPASIFVSCLCLCWGAAAMSSGAARNMGELVVTRCLLGVFEATFGSGAPYFLSLLY
KRRELALRMSLLLGMMPLANTFASSLAYGITQMRGSLEPWRLLFIIEGSFTIVLAPFIYLLLIDSPATAKFLTPE
EQLLAVERLRLRDSTSRRGVQWKQVLAGLGDYKTYVHAAIHFCANYSFAALSNFLPTIVHDMGHDAVSAQGLTAP
AYFVAFLLCLVTSYLSDRIGQRGIMLAGSAAVAVVGYGMLVGFHGAGARYVGVWLAACGSFPALSLNVTWQLNNQ
GGDSKKGAGLAVFLTLGQCSSFVSSAAFPTGDAPLYVRGCAIGCGLAGLMLVLALGMHLVLKAENRRRNRMYGPV
DSEGEVDVTEAGDDHGDFRYVT
Coding >Ophio5|4968
ATGGCCTCGCCGCTGGTCAAGTTCCCGCGCCATGGGCCAACAATGGCTGTCGACAAGGCGGCGGCCGAGGCTCGG
ATTCGGCGCTCCTTCGATGGCCGCGTGCTTCCTCTGCTGTGCTGCCTCTACGTCTGCTCATATCTGGACCGCGGG
AACATTGGGAACGCGAAGACGGCGGGCGCCCAGGATGCGCTGGGACTGGATTCGAGGCAATGGACCTCGGTGCTC
AACTCGTTCTACGCCTGCTACGTTCTCTTCGAGTGGACGACGATGCTGTGGAGGATTCTTCCTGCCAGCATCTTT
GTCTCGTGTCTCTGCCTGTGCTGGGGCGCGGCCGCCATGAGCTCGGGAGCGGCCCGTAACATGGGCGAGCTCGTC
GTGACTCGATGCCTCCTCGGCGTCTTCGAGGCCACCTTTGGCTCCGGCGCGCCTTACTTTCTCTCCCTGCTCTAT
AAGCGACGCGAGCTGGCTTTGCGCATGTCCCTTCTCCTGGGTATGATGCCGCTGGCCAACACGTTTGCCTCGAGC
CTCGCCTACGGCATCACGCAGATGCGCGGCTCGCTCGAGCCGTGGAGGTTGCTGTTCATCATAGAGGGCTCCTTT
ACCATCGTCTTGGCCCCGTTCATTTACCTGCTGCTCATCGACTCGCCCGCCACGGCCAAGTTCCTGACGCCAGAG
GAGCAGCTCCTGGCCGTCGAGCGGCTACGGCTGCGTGACTCGACGTCGCGACGCGGTGTGCAGTGGAAACAAGTG
CTGGCCGGCTTAGGCGACTACAAGACATATGTCCACGCCGCCATTCACTTCTGCGCCAACTACTCCTTCGCCGCG
CTGTCCAATTTCCTGCCGACCATAGTCCACGACATGGGCCACGACGCTGTCAGCGCACAAGGGCTGACGGCGCCA
GCGTATTTTGTCGCCTTCTTGCTCTGCCTCGTCACCTCGTACCTGTCGGACAGGATTGGCCAGCGGGGCATCATG
CTGGCGGGCTCGGCGGCCGTGGCCGTTGTCGGCTACGGGATGCTTGTCGGCTTCCACGGTGCCGGTGCGCGCTAT
GTCGGCGTATGGCTCGCTGCCTGCGGTTCCTTTCCGGCCTTGAGCCTCAACGTCACCTGGCAGCTCAACAACCAG
GGCGGCGACTCCAAGAAGGGTGCCGGCCTGGCCGTGTTCCTGACGCTAGGACAGTGCTCGTCGTTTGTGAGCAGT
GCTGCGTTTCCGACGGGCGACGCCCCGCTATATGTCAGGGGCTGCGCCATCGGCTGCGGTCTGGCTGGACTGATG
CTGGTGCTTGCTCTCGGCATGCACCTTGTCCTGAAAGCGGAGAACCGGCGTCGCAATCGCATGTACGGGCCGGTT
GATAGCGAGGGCGAGGTGGATGTGACGGAGGCGGGTGACGACCACGGCGACTTTCGATACGTGACG
Transcript >Ophio5|4968
ATGGCCTCGCCGCTGGTCAAGTTCCCGCGCCATGGGCCAACAATGGCTGTCGACAAGGCGGCGGCCGAGGCTCGG
ATTCGGCGCTCCTTCGATGGCCGCGTGCTTCCTCTGCTGTGCTGCCTCTACGTCTGCTCATATCTGGACCGCGGG
AACATTGGGAACGCGAAGACGGCGGGCGCCCAGGATGCGCTGGGACTGGATTCGAGGCAATGGACCTCGGTGCTC
AACTCGTTCTACGCCTGCTACGTTCTCTTCGAGTGGACGACGATGCTGTGGAGGATTCTTCCTGCCAGCATCTTT
GTCTCGTGTCTCTGCCTGTGCTGGGGCGCGGCCGCCATGAGCTCGGGAGCGGCCCGTAACATGGGCGAGCTCGTC
GTGACTCGATGCCTCCTCGGCGTCTTCGAGGCCACCTTTGGCTCCGGCGCGCCTTACTTTCTCTCCCTGCTCTAT
AAGCGACGCGAGCTGGCTTTGCGCATGTCCCTTCTCCTGGGTATGATGCCGCTGGCCAACACGTTTGCCTCGAGC
CTCGCCTACGGCATCACGCAGATGCGCGGCTCGCTCGAGCCGTGGAGGTTGCTGTTCATCATAGAGGGCTCCTTT
ACCATCGTCTTGGCCCCGTTCATTTACCTGCTGCTCATCGACTCGCCCGCCACGGCCAAGTTCCTGACGCCAGAG
GAGCAGCTCCTGGCCGTCGAGCGGCTACGGCTGCGTGACTCGACGTCGCGACGCGGTGTGCAGTGGAAACAAGTG
CTGGCCGGCTTAGGCGACTACAAGACATATGTCCACGCCGCCATTCACTTCTGCGCCAACTACTCCTTCGCCGCG
CTGTCCAATTTCCTGCCGACCATAGTCCACGACATGGGCCACGACGCTGTCAGCGCACAAGGGCTGACGGCGCCA
GCGTATTTTGTCGCCTTCTTGCTCTGCCTCGTCACCTCGTACCTGTCGGACAGGATTGGCCAGCGGGGCATCATG
CTGGCGGGCTCGGCGGCCGTGGCCGTTGTCGGCTACGGGATGCTTGTCGGCTTCCACGGTGCCGGTGCGCGCTAT
GTCGGCGTATGGCTCGCTGCCTGCGGTTCCTTTCCGGCCTTGAGCCTCAACGTCACCTGGCAGCTCAACAACCAG
GGCGGCGACTCCAAGAAGGGTGCCGGCCTGGCCGTGTTCCTGACGCTAGGACAGTGCTCGTCGTTTGTGAGCAGT
GCTGCGTTTCCGACGGGCGACGCCCCGCTATATGTCAGGGGCTGCGCCATCGGCTGCGGTCTGGCTGGACTGATG
CTGGTGCTTGCTCTCGGCATGCACCTTGTCCTGAAAGCGGAGAACCGGCGTCGCAATCGCATGTACGGGCCGGTT
GATAGCGAGGGCGAGGTGGATGTGACGGAGGCGGGTGACGACCACGGCGACTTTCGATACGTGACGTGA
Gene >Ophio5|4968
ATGGCCTCGCCGCTGGTCAAGTTCCCGCGCCATGGGCCAACAATGGCTGTCGACAAGGCGGCGGCCGAGGCTCGG
ATTCGGCGCTCCGTATGCTGCCCTGTCGCGTCCTTGGGTGGCGGAATTCGGTGGCTGATGGTTGGAGCGCAGTTC
GATGGCCGCGTGCTTCCTCTGCTGTGCTGCCTCTACGTCTGCTCATATCTGGACCGCGGGAACATTGGGAACGCG
AAGACGGCGGGCGCCCAGGATGCGCTGGGACTGGATTCGAGGCAATGGACCTCGGTGCTCAACTCGTTCTACGCC
TGCTACGTTCTCTTCGAGTGGACGACGATGCTGTGGAGGATTCTTCCTGCCAGCATCTTTGTCTCGTGTCTCTGC
CTGTGGTGGGAGGGGGGCCCTTGTCTTCTACTAGTCCCCTCGGCGGTCTTTCAGCTGACGACTCACCACAGCTGG
GGCGCGGCCGCCATGAGCTCGGGAGCGGCCCGTAACATGGGCGAGCTCGTCGTGACTCGATGCCTCCTCGGCGTC
TTCGAGGCCACCTTTGGCTCCGGCGCGCCTTACTTTCTCTCCCTGCTCTATAAGCGACGCGAGCTGGCTTTGCGC
ATGTCCCTTCTCCTGGGTATGATGCCGCTGGCCAACACGTTTGCCTCGAGCCTCGCCTACGGCATCACGCAGATG
CGCGGCTCGCTCGAGCCGTGGAGGTTGCTGTTCATCATAGGTACTGCGCCTTGTTTCTTCGTGTCAGTGGCGCGG
ACTTAGAGAAATCGGCTGCAGAGGGCTCCTTTACCATCGTCTTGGCCCCGTTCATTTACCTGCTGCTCATCGACT
CGCCCGCCACGGCCAAGTTCCTGACGCCAGAGGAGCAGCTCCTGGCCGTCGAGCGGCTACGGCTGCGTGACTCGA
CGTCGCGACGCGGTGTGCAGTGGAAACAAGTGCTGGCCGGCTTAGGCGACTACAAGACATATGTCCACGCCGCCA
TTCACTTCTGCGCCAACTACTCCTTCGCCGCGCTGTCCAATTTCCTGCCGACCATAGTCCACGACATGGGCCACG
ACGCTGTCAGCGCACAAGGGCTGACGGCGCCAGCGTATTTTGTCGCCTTCTTGCTCTGCCTCGTCACCTCGTACC
TGTCGGACAGGATTGGCCAGCGGGGCATCATGCTGGCGGGCTCGGCGGCCGTGGCCGTTGTCGGCTACGGGATGC
TTGTCGGCTTCCACGGTGCCGGTGCGCGCTATGTCGGCGTATGGCTCGCTGCCTGCGGTTCCTTTCCGGCCTTGA
GCCTCAACGTCACCTGGCAGCTCAACAACCAGGGCGGCGACTCCAAGAAGGGTGCCGGCCTGGCCGTGTTCCTGA
CGCTAGGACAGTGCTCGTCGTTTGTGAGCAGTGCTGCGTTTCCGACGGGCGACGCGTAAGAGAGATTTCCTTCCT
CGTCTCTTCTCTTGTCGAGACTGACGACTGCTGAACCAGCCCGCTATATGTCAGGGGCTGCGCCATCGGCTGCGG
TCTGGCTGGACTGATGCTGGTGCTTGCTCTCGGCATGCACCTTGTCCTGAAAGCGGAGAACCGGCGTCGCAATCG
CATGTACGGGCCGGTTGATAGCGAGGGCGAGGTGGATGTGACGGAGGCGGGTGACGACCACGGCGACTTTCGATA
CGTGACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail