Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4960
Gene name
Locationscaffold_4:40560..42475
Strand-
Gene length (bp)1915
Transcript length (bp)1350
Coding sequence length (bp)1347
Protein length (aa) 449

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 1.8E-06 17 96
PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase 8.6E-06 17 104

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O60078|TYR1_SCHPO Probable prephenate dehydrogenase [NADP(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tyr1 PE=2 SV=1 13 448 1.0E-171
sp|P20049|TYR1_YEAST Prephenate dehydrogenase [NADP(+)] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TYR1 PE=1 SV=2 16 443 8.0E-163
sp|Q58029|Y612_METJA Probable arogenate/prephenate dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0612 PE=3 SV=1 14 250 9.0E-14

GO

GO Term Description Terminal node
GO:0050661 NADP binding Yes
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.6663 0.2565 0.0493 0.1975 0.2214 0.0944 0.1068 0.2012 0.1059 0.129

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4766
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4512
Ophiocordyceps australis map64 (Brazil) OphauB2|3354
Ophiocordyceps camponoti-floridani Ophcf2|01759
Ophiocordyceps camponoti-rufipedis Ophun1|997
Ophiocordyceps kimflemingae Ophio5|4960 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1006

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4960
MASASAFVPAGMEDFVVGLIGMGDMGRMYAERLSAAGWKILACDREDRYDSLRERYTGTKKIEICRNGHLVSRAS
DFIVYSVEAAAIDGVIAQYGPSTKLGAIVGGQTSCKSPEIAAFEAHLPADVSIVSCHSLHGPAVDPHNQPLVLIR
HRAPASALRTVETVLSCLRSKFVYLSALEHDRITADTQAVTHAAFLSMGKAWHANRQFPWEINRYIGGIESVKIN
TMLRIFSQKWHVYAGLAILNPEARKQVAQYAESVTDLYKLMLEGNLGGLRQRVYAARDKVFFRSSATSSWESGPL
VEPDVLASFSHGRPADANDSSPPPPPNNHLSLLAMVDCWAALGIVPYDHMLCSTPLFRLRLGVAEHLFRSTELLD
EALSTAIDDKTYRSDDLEFTFAARGWAECVTLGHFETWRKRFDSTQEFFRPRFAEAKIIGDQMMKKMLESIKQA
Coding >Ophio5|4960
ATGGCTTCCGCCTCTGCTTTCGTCCCGGCTGGGATGGAGGACTTCGTGGTCGGACTCATCGGCATGGGAGACATG
GGGAGAATGTACGCCGAGAGGCTCTCCGCCGCTGGCTGGAAAATCCTGGCCTGCGACAGGGAAGATAGATACGAT
AGCCTGCGAGAGAGATATACCGGAACAAAGAAAATCGAGATCTGCCGCAATGGCCACCTCGTGTCCCGCGCCAGC
GACTTCATCGTCTACAGCGTCGAGGCTGCTGCCATTGACGGCGTCATCGCCCAGTATGGCCCTTCCACCAAGCTA
GGGGCCATCGTTGGCGGCCAGACGTCATGCAAGTCTCCCGAGATAGCCGCCTTTGAGGCCCATCTACCGGCGGAC
GTGTCCATCGTCTCGTGCCACTCCCTCCACGGTCCGGCCGTCGACCCTCACAACCAGCCGCTCGTGCTTATCCGG
CACCGAGCCCCGGCCTCGGCCCTACGGACGGTCGAGACGGTGCTCAGCTGCCTGCGGTCCAAGTTCGTCTACCTG
TCGGCGCTGGAGCACGACCGCATCACGGCCGACACGCAGGCCGTCACGCACGCGGCTTTTTTGTCCATGGGCAAA
GCCTGGCACGCCAATCGCCAATTTCCGTGGGAGATCAACCGGTACATAGGCGGCATCGAGAGCGTCAAGATTAAC
ACAATGCTCCGCATCTTCAGCCAGAAGTGGCACGTCTATGCTGGACTCGCCATCCTCAACCCGGAGGCGCGCAAG
CAGGTGGCCCAGTACGCCGAGAGTGTCACCGACCTCTACAAGCTGATGCTCGAGGGCAACCTCGGAGGCCTCCGT
CAGCGCGTCTATGCTGCCCGCGATAAAGTCTTCTTTCGCTCTTCCGCCACCTCCTCATGGGAGTCGGGCCCGCTC
GTCGAGCCGGACGTGCTGGCGTCCTTCTCTCACGGCCGCCCTGCCGATGCCAACGACTCTTCTCCTCCTCCGCCG
CCCAACAACCACCTCTCGCTGCTGGCCATGGTCGACTGCTGGGCTGCCCTCGGTATCGTGCCGTACGACCACATG
CTGTGCAGCACCCCGCTCTTCCGGCTACGCCTCGGTGTCGCAGAGCATCTCTTCCGCAGCACCGAACTGCTCGAC
GAGGCTCTGAGCACCGCCATCGACGACAAGACGTACCGCAGTGACGACCTCGAGTTCACATTTGCCGCCCGCGGC
TGGGCCGAGTGCGTGACCCTCGGCCATTTCGAAACGTGGAGGAAGCGTTTCGACAGTACTCAGGAATTCTTCCGC
CCACGCTTTGCCGAGGCCAAGATCATTGGCGATCAGATGATGAAGAAGATGCTGGAGAGTATTAAGCAAGCT
Transcript >Ophio5|4960
ATGGCTTCCGCCTCTGCTTTCGTCCCGGCTGGGATGGAGGACTTCGTGGTCGGACTCATCGGCATGGGAGACATG
GGGAGAATGTACGCCGAGAGGCTCTCCGCCGCTGGCTGGAAAATCCTGGCCTGCGACAGGGAAGATAGATACGAT
AGCCTGCGAGAGAGATATACCGGAACAAAGAAAATCGAGATCTGCCGCAATGGCCACCTCGTGTCCCGCGCCAGC
GACTTCATCGTCTACAGCGTCGAGGCTGCTGCCATTGACGGCGTCATCGCCCAGTATGGCCCTTCCACCAAGCTA
GGGGCCATCGTTGGCGGCCAGACGTCATGCAAGTCTCCCGAGATAGCCGCCTTTGAGGCCCATCTACCGGCGGAC
GTGTCCATCGTCTCGTGCCACTCCCTCCACGGTCCGGCCGTCGACCCTCACAACCAGCCGCTCGTGCTTATCCGG
CACCGAGCCCCGGCCTCGGCCCTACGGACGGTCGAGACGGTGCTCAGCTGCCTGCGGTCCAAGTTCGTCTACCTG
TCGGCGCTGGAGCACGACCGCATCACGGCCGACACGCAGGCCGTCACGCACGCGGCTTTTTTGTCCATGGGCAAA
GCCTGGCACGCCAATCGCCAATTTCCGTGGGAGATCAACCGGTACATAGGCGGCATCGAGAGCGTCAAGATTAAC
ACAATGCTCCGCATCTTCAGCCAGAAGTGGCACGTCTATGCTGGACTCGCCATCCTCAACCCGGAGGCGCGCAAG
CAGGTGGCCCAGTACGCCGAGAGTGTCACCGACCTCTACAAGCTGATGCTCGAGGGCAACCTCGGAGGCCTCCGT
CAGCGCGTCTATGCTGCCCGCGATAAAGTCTTCTTTCGCTCTTCCGCCACCTCCTCATGGGAGTCGGGCCCGCTC
GTCGAGCCGGACGTGCTGGCGTCCTTCTCTCACGGCCGCCCTGCCGATGCCAACGACTCTTCTCCTCCTCCGCCG
CCCAACAACCACCTCTCGCTGCTGGCCATGGTCGACTGCTGGGCTGCCCTCGGTATCGTGCCGTACGACCACATG
CTGTGCAGCACCCCGCTCTTCCGGCTACGCCTCGGTGTCGCAGAGCATCTCTTCCGCAGCACCGAACTGCTCGAC
GAGGCTCTGAGCACCGCCATCGACGACAAGACGTACCGCAGTGACGACCTCGAGTTCACATTTGCCGCCCGCGGC
TGGGCCGAGTGCGTGACCCTCGGCCATTTCGAAACGTGGAGGAAGCGTTTCGACAGTACTCAGGAATTCTTCCGC
CCACGCTTTGCCGAGGCCAAGATCATTGGCGATCAGATGATGAAGAAGATGCTGGAGAGTATTAAGCAAGCTTAG
Gene >Ophio5|4960
ATGGCTTCCGCCTCTGCTTTCGTCCCGGCTGGGATGGAGGACTTCGTGGTCGGACTCATCGGCATGGGAGACATG
GGGAGAATGTACGCCGAGAGGCTCTCCGCCGCTGGCTGGAAGTGAGTGTGTTGCGCGCGGCTGTGTCTCGCGAGT
GTTCCAACTGCAGGGTGAGTTGCTACAGAGCCCTGTCCCCCCCCTCTTAACTCCATTGCTTTGTCTTCTCTCTCT
CTCCCCTTCATTGTCTATGATGACTAGAGCGCATTTGGCTCGAGTTTTGCTCGGGGTCGTCCGGGGTCCGTTCCG
GCTCCCGGACAATGGCCCCGAGCCACTCATTGATGAAAACGCTAGCTACCTTTTCAAATCTTCTTGTCTGACACG
ATGATGCTCACAATCTACCCCATTTGTTTCACGGACCTGGTCCTTACTTTACTGCCCCGCCGTTCTTACGATCGC
AAGCTGACCGAGATGATGTCTCACAGAGCATCTCACAGAGCAGATGAATAACCGTAGACGCTCTCCCGTCACAGA
ATCCTGGCCTGCGACAGGGAAGATAGATACGATAGCCTGCGAGAGAGATATACCGGAACAGTACGACCTTGTTGA
TATCGTGCCTGCTCCCAATGATGCTCTGACACTGAAGCCCAATTGCCCTGCAGAAGAAAATCGAGATCTGCCGCA
ATGGCCACCTCGTGTCCCGCGCCAGCGACTTCATCGTCTACAGCGTCGAGGCTGCTGCCATTGACGGCGTCATCG
CCCAGTATGGCCCTTGTACGAGTCTCCTCCCCATCGCGGCGAGCCAATGGTCCACCAGTTTCTTCTCTTGACGCC
CGGTTCTGACGGACATTTTGGCGATGTAGCCACCAAGCTAGGGGCCATCGTTGGCGGCCAGACGTCATGCAAGTC
TCCCGAGATAGCCGCCTTTGAGGCCCATCTACCGGCGGACGTGTCCATCGTCTCGTGCCACTCCCTCCACGGTCC
GGCCGTCGACCCTCACAACCAGCCGCTCGTGCTTATCCGGCACCGAGCCCCGGCCTCGGCCCTACGGACGGTCGA
GACGGTGCTCAGCTGCCTGCGGTCCAAGTTCGTCTACCTGTCGGCGCTGGAGCACGACCGCATCACGGCCGACAC
GCAGGCCGTCACGCACGCGGCTTTTTTGTCCATGGGCAAAGCCTGGCACGCCAATCGCCAATTTCCGTGGGAGAT
CAACCGGTACATAGGCGGCATCGAGAGCGTCAAGATTAACACAATGCTCCGCATCTTCAGCCAGAAGTGGCACGT
CTATGCTGGACTCGCCATCCTCAACCCGGAGGCGCGCAAGCAGGTGGCCCAGTACGCCGAGAGTGTCACCGACCT
CTACAAGCTGATGCTCGAGGGCAACCTCGGAGGCCTCCGTCAGCGCGTCTATGCTGCCCGCGATAAAGTCTTCTT
TCGCTCTTCCGCCACCTCCTCATGGGAGTCGGGCCCGCTCGTCGAGCCGGACGTGCTGGCGTCCTTCTCTCACGG
CCGCCCTGCCGATGCCAACGACTCTTCTCCTCCTCCGCCGCCCAACAACCACCTCTCGCTGCTGGCCATGGTCGA
CTGCTGGGCTGCCCTCGGTATCGTGCCGTACGACCACATGCTGTGCAGCACCCCGCTCTTCCGGCTACGCCTCGG
TGTCGCAGAGCATCTCTTCCGCAGCACCGAACTGCTCGACGAGGCTCTGAGCACCGCCATCGACGACAAGACGTA
CCGCAGTGACGACCTCGAGTTCACATTTGCCGCCCGCGGCTGGGCCGAGTGCGTGACCCTCGGCCATTTCGAAAC
GTGGAGGAAGCGTTTCGACAGTACTCAGGAATTCTTCCGCCCACGCTTTGCCGAGGCCAAGATCATTGGCGATCA
GATGATGAAGAAGATGCTGGAGAGTATTAAGCAAGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail