Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4958
Gene name
Locationscaffold_4:36053..36994
Strand-
Gene length (bp)941
Transcript length (bp)810
Coding sequence length (bp)807
Protein length (aa) 269

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04117 Mpv17_PMP22 Mpv17 / PMP22 family 6.6E-10 171 226

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9ZS51|PMP22_ARATH Peroxisomal membrane protein PMP22 OS=Arabidopsis thaliana GN=PMP22 PE=1 SV=1 58 241 1.0E-12
sp|Q54GD8|PX24C_DICDI PXMP2/4 family protein 3 OS=Dictyostelium discoideum GN=DDB_G0290223 PE=3 SV=1 54 234 1.0E-10
sp|Q2KIY1|PXMP2_BOVIN Peroxisomal membrane protein 2 OS=Bos taurus GN=PXMP2 PE=2 SV=3 58 231 4.0E-10
sp|Q54FR4|PX24D_DICDI PXMP2/4 family protein 4 OS=Dictyostelium discoideum GN=DDB_G0290631 PE=3 SV=1 61 230 1.0E-07
sp|Q07066|PXMP2_RAT Peroxisomal membrane protein 2 OS=Rattus norvegicus GN=Pxmp2 PE=1 SV=2 58 231 9.0E-06

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 110 132 22
2 145 167 22
3 210 229 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 209.86 113.75 305.97
CcL In ants, during behavior modification 347.79 175.39 520.19
CcD In ants, recently dead 332.43 172.55 492.31

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.029109 yes
SC16a CcD 0.042405 yes
CcL CcD 0.882534 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4958
MSVKFERETVKQTAQSVLSSAVPEHGSIPGTSGRHPIAERVGTALTGGMKNAGTEGYLAAYIKQLESNPLRTKMF
TAGSLAGAQELIASWLAKDRNKHGHYFTSRVPKMAAYGAIVSAPLGHFLIWLLQSFFRGRTSLKAKVMQIIVSNL
VIAPIQNSIYLVAMALIAGARTYHQVRATVKVGFWRVMRVSWITSPICLAFAQKFLPDELWVPFFNLVSFVIGTY
INTVTKKKRLAALRRKHFGDGRNNSGMGRSDDYPPQPMGPNPPY
Coding >Ophio5|4958
ATGTCGGTCAAGTTCGAGCGCGAGACAGTCAAGCAGACGGCCCAAAGCGTCCTCTCCAGTGCCGTTCCTGAGCAT
GGCTCTATCCCCGGCACAAGCGGCCGGCATCCCATCGCCGAGCGTGTCGGCACCGCCCTCACCGGCGGCATGAAG
AACGCCGGCACCGAGGGTTACTTGGCCGCATACATCAAGCAGCTCGAGTCCAACCCGCTGCGCACCAAGATGTTC
ACTGCCGGGTCCCTCGCCGGTGCACAGGAGCTCATCGCCTCGTGGCTGGCCAAGGATCGCAACAAACACGGCCAT
TACTTCACCTCGCGCGTCCCCAAGATGGCCGCATATGGCGCCATCGTCAGCGCGCCCCTGGGCCACTTCCTCATC
TGGCTCCTGCAAAGCTTCTTCCGCGGCCGCACCAGTCTCAAGGCCAAGGTCATGCAAATCATCGTCAGCAACTTG
GTCATTGCGCCCATTCAGAACAGTATCTACTTGGTCGCCATGGCCCTGATTGCTGGTGCGCGCACCTATCACCAG
GTCCGCGCCACCGTCAAGGTTGGCTTCTGGAGAGTTATGCGCGTCTCGTGGATCACGTCGCCCATTTGCCTCGCC
TTTGCTCAAAAGTTCCTGCCCGACGAGCTCTGGGTGCCGTTCTTCAACCTCGTATCCTTCGTCATCGGTACCTAC
ATCAACACCGTCACCAAGAAGAAGCGCCTCGCCGCCCTTCGCAGAAAGCACTTTGGCGACGGCCGCAACAACAGC
GGCATGGGCCGATCCGACGATTATCCTCCTCAACCCATGGGCCCGAACCCGCCTTAC
Transcript >Ophio5|4958
ATGTCGGTCAAGTTCGAGCGCGAGACAGTCAAGCAGACGGCCCAAAGCGTCCTCTCCAGTGCCGTTCCTGAGCAT
GGCTCTATCCCCGGCACAAGCGGCCGGCATCCCATCGCCGAGCGTGTCGGCACCGCCCTCACCGGCGGCATGAAG
AACGCCGGCACCGAGGGTTACTTGGCCGCATACATCAAGCAGCTCGAGTCCAACCCGCTGCGCACCAAGATGTTC
ACTGCCGGGTCCCTCGCCGGTGCACAGGAGCTCATCGCCTCGTGGCTGGCCAAGGATCGCAACAAACACGGCCAT
TACTTCACCTCGCGCGTCCCCAAGATGGCCGCATATGGCGCCATCGTCAGCGCGCCCCTGGGCCACTTCCTCATC
TGGCTCCTGCAAAGCTTCTTCCGCGGCCGCACCAGTCTCAAGGCCAAGGTCATGCAAATCATCGTCAGCAACTTG
GTCATTGCGCCCATTCAGAACAGTATCTACTTGGTCGCCATGGCCCTGATTGCTGGTGCGCGCACCTATCACCAG
GTCCGCGCCACCGTCAAGGTTGGCTTCTGGAGAGTTATGCGCGTCTCGTGGATCACGTCGCCCATTTGCCTCGCC
TTTGCTCAAAAGTTCCTGCCCGACGAGCTCTGGGTGCCGTTCTTCAACCTCGTATCCTTCGTCATCGGTACCTAC
ATCAACACCGTCACCAAGAAGAAGCGCCTCGCCGCCCTTCGCAGAAAGCACTTTGGCGACGGCCGCAACAACAGC
GGCATGGGCCGATCCGACGATTATCCTCCTCAACCCATGGGCCCGAACCCGCCTTACTAG
Gene >Ophio5|4958
ATGTCGGTCAAGTTCGAGCGCGAGACAGTCAAGCAGACGGCCCAAAGCGTCCTCTCCAGTGCCGTTCCTGAGCAT
GGCTCTATCCCCGGCACAAGCGGCCGGCATCCCATCGCCGAGCGTGTCGGCACCGCCCTCACCGGCGGCATGAAG
AACGCCGGCACCGAGGGTTACTTGGCCGTATGTCGCCACGGCCTCGTCTGCCCGTAACGAGCTGACGTTTCCTCC
CCTTCCACCCCCAGGCATACATCAAGCAGCTCGAGTCCAACCCGCTGCGCACCAAGATGTTCACTGCCGGGTCCC
TCGCCGGTGCACAGGAGCTCATCGCCTCGTGGCTGGCCAAGGATCGCAACAAACACGGCCATTACTTCACCTCGC
GCGTCCCCAAGATGGCCGCATATGGCGCCATCGTCAGCGCGCCCCTGGGCCACTTCCTCATCTGGCTCCTGCAAA
GCTTCTTCCGCGGCCGCACCAGTCTCAAGGCCAAGGTCATGCAAATCATCGTCAGCAACTTGGTCGTGCGTGGAC
CCCTGACTCGAGAGCTTTGCCCTCGTCCTTCAAGCGACTGACTAATTGACGGCATCCAGATTGCGCCCATTCAGA
ACAGTATCTACTTGGTCGCCATGGCCCTGATTGCTGGTGCGCGCACCTATCACCAGGTCCGCGCCACCGTCAAGG
TTGGCTTCTGGAGAGTTATGCGCGTCTCGTGGATCACGTCGCCCATTTGCCTCGCCTTTGCTCAAAAGTTCCTGC
CCGACGAGCTCTGGGTGCCGTTCTTCAACCTCGTATCCTTCGTCATCGGTACCTACATCAACACCGTCACCAAGA
AGAAGCGCCTCGCCGCCCTTCGCAGAAAGCACTTTGGCGACGGCCGCAACAACAGCGGCATGGGCCGATCCGACG
ATTATCCTCCTCAACCCATGGGCCCGAACCCGCCTTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail