Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4957
Gene name
Locationscaffold_4:34884..35667
Strand+
Gene length (bp)783
Transcript length (bp)783
Coding sequence length (bp)780
Protein length (aa) 260

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04157 EAP30 EAP30/Vps36 family 4.5E-72 6 237

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RJU0|SNF8_XENTR Vacuolar-sorting protein SNF8 OS=Xenopus tropicalis GN=snf8 PE=2 SV=1 1 251 2.0E-64
sp|Q9CZ28|SNF8_MOUSE Vacuolar-sorting protein SNF8 OS=Mus musculus GN=Snf8 PE=1 SV=1 1 251 9.0E-64
sp|Q5RK19|SNF8_RAT Vacuolar-sorting protein SNF8 OS=Rattus norvegicus GN=Snf8 PE=1 SV=1 1 251 1.0E-63
sp|Q96H20|SNF8_HUMAN Vacuolar-sorting protein SNF8 OS=Homo sapiens GN=SNF8 PE=1 SV=1 1 251 1.0E-63
sp|Q5U3V9|SNF8_DANRE Vacuolar-sorting protein SNF8 OS=Danio rerio GN=snf8 PE=2 SV=2 1 260 2.0E-62
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RJU0|SNF8_XENTR Vacuolar-sorting protein SNF8 OS=Xenopus tropicalis GN=snf8 PE=2 SV=1 1 251 2.0E-64
sp|Q9CZ28|SNF8_MOUSE Vacuolar-sorting protein SNF8 OS=Mus musculus GN=Snf8 PE=1 SV=1 1 251 9.0E-64
sp|Q5RK19|SNF8_RAT Vacuolar-sorting protein SNF8 OS=Rattus norvegicus GN=Snf8 PE=1 SV=1 1 251 1.0E-63
sp|Q96H20|SNF8_HUMAN Vacuolar-sorting protein SNF8 OS=Homo sapiens GN=SNF8 PE=1 SV=1 1 251 1.0E-63
sp|Q5U3V9|SNF8_DANRE Vacuolar-sorting protein SNF8 OS=Danio rerio GN=snf8 PE=2 SV=2 1 260 2.0E-62
sp|O94663|SNF8_SCHPO Vacuolar-sorting protein dot2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dot2 PE=3 SV=1 3 258 5.0E-59
sp|Q5M759|VP221_ARATH Vacuolar protein sorting-associated protein 22 homolog 1 OS=Arabidopsis thaliana GN=VP22-1 PE=2 SV=2 3 248 1.0E-54
sp|Q12483|SNF8_YEAST Vacuolar-sorting protein SNF8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF8 PE=1 SV=1 4 251 7.0E-50
sp|Q54RC4|SNF8_DICDI Vacuolar-sorting protein SNF8 OS=Dictyostelium discoideum GN=snf8 PE=3 SV=1 3 250 6.0E-45
sp|Q9LIJ4|VP222_ARATH Putative vacuolar protein sorting-associated protein 22 homolog 2 OS=Arabidopsis thaliana GN=VP22-2 PE=5 SV=1 71 196 1.0E-28
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4957
MSRKGVGIGAFDRSRLTSQHYASHGSSLRASNASALSSQLAVFRALLQQFAQTHAKDIRSDPAFRAQFARMCTAI
GVDPLASGDSSSGGGSIWAQLLGKTVNDFYFGLAVRVVDVCGATRGENGGLIGLRELSDRLSRHRQEAAANGADI
TEDDVRRAVETLKPLGGGYGIIRVGRKEYVRSVPRELSSDQAAVVEAVQVLGYVSVGMLRDNLAWETARCRTVID
DLVAQGMLWVDKQTRGEWEFWSPSFMVHADDGAPE
Coding >Ophio5|4957
ATGTCCCGCAAGGGCGTCGGCATCGGCGCCTTCGACCGGTCCCGCCTCACATCGCAGCACTACGCTTCTCACGGC
TCCTCGCTACGGGCGAGCAACGCCTCAGCGCTGTCCAGCCAGCTAGCCGTCTTCCGCGCCCTGTTGCAACAGTTT
GCGCAAACGCACGCCAAGGACATACGTTCCGACCCTGCGTTCCGAGCGCAATTCGCGCGCATGTGCACCGCCATC
GGTGTCGATCCCCTCGCCAGCGGTGACAGCAGCTCCGGCGGTGGGAGTATCTGGGCTCAGCTACTCGGCAAGACG
GTCAATGATTTTTACTTTGGTCTTGCCGTACGCGTCGTCGATGTCTGTGGCGCCACCAGAGGGGAGAATGGTGGC
TTGATTGGGCTTCGTGAGTTGAGCGATCGCCTCTCCCGTCATAGGCAGGAGGCTGCTGCCAACGGTGCCGATATT
ACCGAGGACGACGTCCGCCGCGCTGTTGAGACGCTCAAGCCCCTCGGAGGCGGATACGGTATCATCCGCGTCGGA
CGCAAGGAATACGTTCGCAGCGTGCCGCGCGAGCTGAGCAGCGACCAGGCCGCCGTTGTCGAGGCCGTCCAGGTC
TTGGGCTACGTCAGCGTCGGCATGCTGCGCGACAATCTGGCCTGGGAGACGGCCCGCTGTCGTACCGTCATTGAC
GACCTCGTTGCTCAGGGCATGCTCTGGGTCGATAAGCAGACGCGAGGCGAGTGGGAGTTTTGGAGCCCCAGCTTC
ATGGTCCACGCCGACGACGGCGCTCCCGAG
Transcript >Ophio5|4957
ATGTCCCGCAAGGGCGTCGGCATCGGCGCCTTCGACCGGTCCCGCCTCACATCGCAGCACTACGCTTCTCACGGC
TCCTCGCTACGGGCGAGCAACGCCTCAGCGCTGTCCAGCCAGCTAGCCGTCTTCCGCGCCCTGTTGCAACAGTTT
GCGCAAACGCACGCCAAGGACATACGTTCCGACCCTGCGTTCCGAGCGCAATTCGCGCGCATGTGCACCGCCATC
GGTGTCGATCCCCTCGCCAGCGGTGACAGCAGCTCCGGCGGTGGGAGTATCTGGGCTCAGCTACTCGGCAAGACG
GTCAATGATTTTTACTTTGGTCTTGCCGTACGCGTCGTCGATGTCTGTGGCGCCACCAGAGGGGAGAATGGTGGC
TTGATTGGGCTTCGTGAGTTGAGCGATCGCCTCTCCCGTCATAGGCAGGAGGCTGCTGCCAACGGTGCCGATATT
ACCGAGGACGACGTCCGCCGCGCTGTTGAGACGCTCAAGCCCCTCGGAGGCGGATACGGTATCATCCGCGTCGGA
CGCAAGGAATACGTTCGCAGCGTGCCGCGCGAGCTGAGCAGCGACCAGGCCGCCGTTGTCGAGGCCGTCCAGGTC
TTGGGCTACGTCAGCGTCGGCATGCTGCGCGACAATCTGGCCTGGGAGACGGCCCGCTGTCGTACCGTCATTGAC
GACCTCGTTGCTCAGGGCATGCTCTGGGTCGATAAGCAGACGCGAGGCGAGTGGGAGTTTTGGAGCCCCAGCTTC
ATGGTCCACGCCGACGACGGCGCTCCCGAGTGA
Gene >Ophio5|4957
ATGTCCCGCAAGGGCGTCGGCATCGGCGCCTTCGACCGGTCCCGCCTCACATCGCAGCACTACGCTTCTCACGGC
TCCTCGCTACGGGCGAGCAACGCCTCAGCGCTGTCCAGCCAGCTAGCCGTCTTCCGCGCCCTGTTGCAACAGTTT
GCGCAAACGCACGCCAAGGACATACGTTCCGACCCTGCGTTCCGAGCGCAATTCGCGCGCATGTGCACCGCCATC
GGTGTCGATCCCCTCGCCAGCGGTGACAGCAGCTCCGGCGGTGGGAGTATCTGGGCTCAGCTACTCGGCAAGACG
GTCAATGATTTTTACTTTGGTCTTGCCGTACGCGTCGTCGATGTCTGTGGCGCCACCAGAGGGGAGAATGGTGGC
TTGATTGGGCTTCGTGAGTTGAGCGATCGCCTCTCCCGTCATAGGCAGGAGGCTGCTGCCAACGGTGCCGATATT
ACCGAGGACGACGTCCGCCGCGCTGTTGAGACGCTCAAGCCCCTCGGAGGCGGATACGGTATCATCCGCGTCGGA
CGCAAGGAATACGTTCGCAGCGTGCCGCGCGAGCTGAGCAGCGACCAGGCCGCCGTTGTCGAGGCCGTCCAGGTC
TTGGGCTACGTCAGCGTCGGCATGCTGCGCGACAATCTGGCCTGGGAGACGGCCCGCTGTCGTACCGTCATTGAC
GACCTCGTTGCTCAGGGCATGCTCTGGGTCGATAAGCAGACGCGAGGCGAGTGGGAGTTTTGGAGCCCCAGCTTC
ATGGTCCACGCCGACGACGGCGCTCCCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail