Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4949
Gene name
Locationscaffold_4:14759..19017
Strand-
Gene length (bp)4258
Transcript length (bp)4137
Coding sequence length (bp)4134
Protein length (aa) 1378

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14664 RICTOR_N Rapamycin-insensitive companion of mTOR, N-term 2.2E-134 240 616
PF14666 RICTOR_M Rapamycin-insensitive companion of mTOR, middle domain 4.2E-36 815 915
PF14663 RasGEF_N_2 Rapamycin-insensitive companion of mTOR RasGEF_N domain 1.6E-34 933 1036
PF14668 RICTOR_V Rapamycin-insensitive companion of mTOR, domain 5 6.1E-29 1110 1179
PF02185 HR1 Hr1 repeat 4.3E-15 109 173

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09743|STE16_SCHPO Protein ste16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste16 PE=3 SV=1 240 1320 0.0E+00
sp|P40061|TSC11_YEAST Target of rapamycin complex 2 subunit TSC11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSC11 PE=1 SV=1 216 1207 4.0E-114
sp|O77203|PIAA_DICDI Protein pianissimo A OS=Dictyostelium discoideum GN=piaA PE=1 SV=1 226 1316 3.0E-113
sp|Q6R327|RICTR_HUMAN Rapamycin-insensitive companion of mTOR OS=Homo sapiens GN=RICTOR PE=1 SV=1 213 1180 7.0E-108
sp|Q6QI06|RICTR_MOUSE Rapamycin-insensitive companion of mTOR OS=Mus musculus GN=Rictor PE=1 SV=2 213 1180 4.0E-107

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0065007 biological regulation No
GO:0050794 regulation of cellular process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6784 0.4239 0.2019 0.098 0.1281 0.0031 0.0992 0.242 0.1596 0.052

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5630
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4502
Ophiocordyceps australis map64 (Brazil) OphauB2|3362
Ophiocordyceps camponoti-floridani Ophcf2|01749
Ophiocordyceps camponoti-rufipedis Ophun1|2214
Ophiocordyceps kimflemingae Ophio5|4949 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7721

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4949
MIMPPSSSQQNSLYHQQQTGRTSFDRDGAALQPPNGSQSRKLSASAISFAPRGSSLNPNPGVGSFSSDLRNQTMS
SRAGSRAEAGSMYPSSFTDKVEEDDAAAAAEQALAVLKDKLNREMKIKEGSENMLEALNIKKAKQTKEQRQRVEA
ELSASNARIKELRQKIADAQRSKALPPATPTRSRNQDGLLQSNGLLRSPPSISRSAIGSDIDEMLESPTFLLAEL
LQALEVEGMPPEYYVSRANQLVELFKRHPAIKYDLVWSIFGLRMQMMLLSESREVVAAGYRATRYAITDVASLKK
IRSLNVDYLVIRSLNNYRKADVEREQALKFVRAFLDVKDGVRQVSRAVVRTIVAVAEQSEDRRPGVQVADHNIDR
LRPICIETLAEIMVQDPRLLVASGGLGPLCDALAEGTYKAPESLVSSFLYLLDTPGRRGYMQPGYGLEMVFTAFT
DQLASAESILKQNSRAISVALKSWSGLMALCMYDFRSIRSLIASILFPNPAIRETVLDLFFSLLRIKPPAWATSF
LAGRRLTTYGRVANMKSTSGRERSATLSHEEDTGEQNFVDHYTALLLAVFIRAGLLQSLLRIAQSEEEPTLKRKT
TLLIGEVLKLASRLLPPSWSAELQLLPELFAAAAQFGNESHFVASGIVYQISSVSRTLYRSAPSESMGGTLPSSD
SMQNLLMMEEHPKANAAVVFDDATFRQLLLDTGVLNSSNYLKWNWDVIVKVIDGPLQIGKRLEEAIKASKFMKRI
MSFYRPFKYKFAEIRSTRNTHKYVKAGCALVHSLLQSPEGIRVLADSKLLRQIAECLAQCDPTSGLTAQFPMFAK
DRLTDTLCGGYFPMLGVLSSDANGLLLLERWRMFNMMYHIVDLKQRPDLIKLLLSNFDYSLQGHPRVLLSKALVA
GTKEIRIHATNTLRKCTMRPISSLGGQGNASDSKWAIKLLVTQLYDPEIEVCSTAVKILENACNRKTFLEYIVEC
RPALDHLGEIGAPLLLRFLSTSIGYHYLDGLDYISNEMDDWFLGRNDSYVGVIEASLARAFLARPDDHSHRGSMF
DETEAETDYHDSHVPPHFYRELTRTREGCKLLSDKGHFDEFAATIRDHGMQTEDGELMTKVKGCLWAVGNVGSME
LGAPFLESSDVVQRIVRVAESHEVMSLRGTAFFVLGLISRSTHGLEILSEHGWDANTTPMGASLGLCIPNELSKL
FSIQPWKHVKAASITLLDTQRTIKEQPPVRQARPPLAPSEMPPLLSEADVNERIMELIVDLGNMVLYKKALTDLQ
RVKQRKPKAFRSVDFFKKVMGLMEWNHYRLGVRRLVIDLFEKNVMRQVVFGDDEGDGGAGVGATGDGGEDSSEGD
DRTERQRSISEPADMPSDLVPAPLQLRR
Coding >Ophio5|4949
ATGATCATGCCCCCCTCATCCTCCCAGCAAAACTCCCTCTATCATCAGCAGCAAACCGGCCGCACCAGCTTCGAC
CGCGATGGCGCCGCTCTGCAGCCTCCCAACGGCAGCCAGTCCCGCAAACTGTCCGCCTCTGCTATATCCTTCGCG
CCCCGCGGCAGCAGCCTCAATCCCAACCCGGGTGTCGGCAGCTTCAGCTCCGACCTGCGAAACCAAACAATGTCC
AGCCGCGCCGGCAGTCGCGCAGAGGCTGGATCCATGTATCCCAGCAGCTTCACGGATAAGGTCGAGGAAGACGAT
GCGGCGGCGGCGGCAGAACAAGCCCTAGCCGTGCTCAAGGACAAGCTGAACCGCGAGATGAAGATCAAGGAAGGC
AGCGAAAACATGCTCGAGGCGCTCAACATAAAAAAGGCCAAGCAGACCAAGGAGCAGCGTCAAAGGGTCGAGGCG
GAGCTGAGCGCGAGCAACGCCAGGATCAAGGAGCTCCGGCAAAAGATAGCTGATGCCCAGCGCTCGAAAGCTCTT
CCTCCGGCAACGCCCACCAGGAGTCGGAACCAGGATGGTTTGTTGCAGTCCAACGGTCTGCTGCGCTCGCCACCG
AGCATCTCACGATCGGCAATTGGTTCAGATATTGACGAGATGTTAGAGAGCCCGACCTTCCTTCTGGCCGAGCTC
CTGCAGGCGCTCGAGGTAGAGGGCATGCCGCCAGAGTACTACGTCAGCCGTGCCAACCAGCTCGTCGAGCTATTC
AAAAGGCATCCGGCCATCAAATATGATCTGGTATGGTCCATCTTTGGGCTGCGCATGCAAATGATGCTGCTGAGC
GAGAGCCGCGAAGTCGTCGCCGCCGGCTATCGAGCCACCAGATACGCAATAACGGACGTGGCATCGCTCAAGAAG
ATCCGTAGCCTCAACGTTGACTACTTGGTCATTAGGTCTCTGAACAACTACCGCAAGGCCGATGTTGAGCGCGAG
CAAGCCCTCAAGTTCGTCCGAGCCTTTCTCGATGTCAAGGACGGCGTCAGGCAGGTTTCCCGCGCCGTAGTGCGC
ACCATCGTCGCCGTCGCCGAGCAGAGCGAAGACCGACGGCCCGGCGTGCAGGTCGCCGACCACAATATCGACCGG
TTGCGGCCGATATGCATAGAGACGCTTGCCGAGATCATGGTACAGGACCCGCGTCTACTCGTCGCGTCAGGAGGT
CTCGGGCCGCTCTGCGACGCCCTGGCCGAGGGCACCTACAAGGCACCGGAGAGCCTCGTGTCGTCCTTTCTCTAC
CTGCTCGACACGCCCGGCCGCCGCGGGTACATGCAGCCCGGCTATGGTCTGGAAATGGTCTTTACCGCCTTCACC
GACCAGCTCGCGAGCGCCGAAAGCATACTCAAGCAGAATTCGCGGGCCATCTCCGTCGCCTTGAAGTCGTGGTCC
GGTCTCATGGCCCTCTGCATGTACGACTTCCGCTCGATCCGCTCCCTCATCGCGAGCATCCTCTTCCCCAACCCC
GCCATTCGCGAGACCGTCCTCGACCTGTTCTTCTCCCTTTTGCGGATCAAGCCGCCCGCATGGGCGACGTCCTTT
CTGGCGGGGCGGAGGTTGACGACGTATGGCAGAGTGGCCAATATGAAGTCGACCAGCGGCAGGGAGCGAAGCGCC
ACGCTCTCTCACGAAGAGGACACGGGCGAGCAAAACTTCGTCGACCACTACACGGCGCTGCTGCTGGCTGTCTTT
ATCAGGGCCGGCCTGCTGCAGAGCCTGCTGCGGATCGCGCAGTCGGAAGAGGAACCCACGCTGAAGCGCAAGACG
ACGCTGCTGATAGGGGAGGTACTGAAGTTGGCCAGCCGGCTGCTGCCCCCGTCGTGGAGCGCCGAGCTTCAGCTC
TTACCGGAGCTGTTCGCGGCGGCCGCGCAGTTTGGCAACGAGTCGCACTTCGTCGCGTCGGGCATCGTGTATCAG
ATCAGCAGCGTCAGCAGGACTCTGTATCGGAGCGCTCCATCCGAGTCCATGGGCGGTACCCTTCCGTCGAGCGAC
AGCATGCAGAACCTGTTGATGATGGAGGAGCATCCCAAGGCCAACGCTGCCGTGGTGTTCGACGACGCCACGTTC
CGCCAGCTTCTCCTTGACACGGGGGTGCTCAATAGCTCCAACTACTTGAAGTGGAACTGGGATGTCATTGTCAAG
GTCATAGACGGGCCGCTGCAGATCGGGAAGCGGTTGGAGGAGGCCATTAAGGCGTCCAAGTTTATGAAGCGCATC
ATGAGCTTTTACAGGCCGTTCAAGTACAAGTTTGCGGAAATCAGGAGCACGCGCAATACTCACAAGTATGTCAAG
GCCGGTTGCGCGTTGGTACACTCCCTCCTCCAATCCCCAGAGGGCATCAGGGTCCTGGCGGATAGCAAGCTGCTG
AGGCAGATTGCCGAGTGCCTGGCCCAGTGCGATCCGACCAGCGGGCTCACGGCCCAGTTCCCTATGTTCGCCAAG
GATCGACTTACCGACACGCTCTGTGGAGGCTATTTCCCGATGCTTGGCGTCCTCAGCAGCGACGCCAATGGGCTT
CTCCTTCTCGAGAGGTGGAGGATGTTCAACATGATGTACCACATCGTCGACCTGAAGCAGCGACCCGATCTCATC
AAGCTCCTCCTGTCCAACTTTGACTACAGCCTCCAGGGACACCCTCGCGTTCTACTATCCAAGGCTCTGGTCGCG
GGCACCAAGGAGATCCGGATTCATGCGACGAACACGCTGCGAAAGTGCACCATGCGGCCCATCTCTTCGCTGGGC
GGTCAGGGCAACGCCAGCGACTCCAAGTGGGCCATTAAGCTTCTCGTGACGCAGCTGTACGACCCAGAGATTGAG
GTCTGCTCGACTGCCGTCAAGATCCTGGAGAACGCGTGTAACCGGAAGACGTTTCTCGAATACATTGTCGAGTGT
CGACCGGCGTTGGACCACCTGGGCGAAATCGGAGCGCCGCTACTGCTGCGATTCCTGTCGACGTCGATCGGATAC
CACTACCTAGACGGGCTGGACTACATCAGCAACGAGATGGACGACTGGTTTCTCGGTCGAAACGACTCGTATGTC
GGCGTCATCGAGGCCAGCCTGGCGAGGGCTTTCCTGGCGAGACCGGACGACCACAGCCACCGCGGCAGCATGTTT
GACGAGACGGAAGCCGAGACGGACTACCACGACAGCCACGTACCGCCGCACTTTTACCGGGAGCTGACGCGCACG
CGCGAAGGCTGCAAGCTGCTGAGCGACAAGGGCCACTTTGACGAGTTTGCGGCGACGATCCGCGACCACGGGATG
CAGACGGAGGATGGCGAGCTGATGACCAAGGTCAAGGGCTGTCTCTGGGCCGTGGGCAATGTCGGCTCGATGGAG
CTGGGCGCGCCGTTTCTGGAATCGAGCGACGTGGTGCAGCGCATTGTACGCGTGGCCGAGTCACACGAGGTCATG
AGTCTGCGCGGCACCGCCTTTTTCGTGCTGGGTCTCATCTCGCGCTCGACACACGGCCTGGAGATCCTCTCGGAG
CATGGGTGGGACGCGAACACGACGCCGATGGGGGCATCGCTCGGCCTCTGCATCCCCAACGAGCTGTCCAAGCTC
TTCTCGATTCAGCCGTGGAAGCACGTCAAGGCGGCGTCCATTACGCTACTCGATACGCAGCGGACGATAAAGGAG
CAGCCTCCGGTGCGACAGGCGCGGCCACCGCTGGCGCCGTCGGAGATGCCGCCGCTGTTGAGCGAGGCGGACGTC
AACGAGCGCATCATGGAGCTCATCGTCGACCTAGGCAACATGGTGCTATATAAAAAGGCGCTGACGGACCTGCAG
CGGGTCAAGCAGCGCAAGCCCAAGGCGTTCCGCAGCGTCGATTTCTTCAAGAAGGTCATGGGCCTGATGGAGTGG
AACCACTACCGGCTCGGGGTGCGACGGCTGGTGATTGACCTGTTTGAGAAGAACGTGATGCGGCAGGTCGTCTTT
GGCGACGACGAGGGCGACGGCGGAGCGGGCGTGGGAGCGACAGGTGACGGCGGCGAAGACAGCAGCGAGGGAGAC
GATCGGACGGAGAGGCAAAGGAGCATCAGCGAGCCAGCCGATATGCCCTCGGACCTGGTGCCTGCGCCTCTCCAG
CTGCGGCGA
Transcript >Ophio5|4949
ATGATCATGCCCCCCTCATCCTCCCAGCAAAACTCCCTCTATCATCAGCAGCAAACCGGCCGCACCAGCTTCGAC
CGCGATGGCGCCGCTCTGCAGCCTCCCAACGGCAGCCAGTCCCGCAAACTGTCCGCCTCTGCTATATCCTTCGCG
CCCCGCGGCAGCAGCCTCAATCCCAACCCGGGTGTCGGCAGCTTCAGCTCCGACCTGCGAAACCAAACAATGTCC
AGCCGCGCCGGCAGTCGCGCAGAGGCTGGATCCATGTATCCCAGCAGCTTCACGGATAAGGTCGAGGAAGACGAT
GCGGCGGCGGCGGCAGAACAAGCCCTAGCCGTGCTCAAGGACAAGCTGAACCGCGAGATGAAGATCAAGGAAGGC
AGCGAAAACATGCTCGAGGCGCTCAACATAAAAAAGGCCAAGCAGACCAAGGAGCAGCGTCAAAGGGTCGAGGCG
GAGCTGAGCGCGAGCAACGCCAGGATCAAGGAGCTCCGGCAAAAGATAGCTGATGCCCAGCGCTCGAAAGCTCTT
CCTCCGGCAACGCCCACCAGGAGTCGGAACCAGGATGGTTTGTTGCAGTCCAACGGTCTGCTGCGCTCGCCACCG
AGCATCTCACGATCGGCAATTGGTTCAGATATTGACGAGATGTTAGAGAGCCCGACCTTCCTTCTGGCCGAGCTC
CTGCAGGCGCTCGAGGTAGAGGGCATGCCGCCAGAGTACTACGTCAGCCGTGCCAACCAGCTCGTCGAGCTATTC
AAAAGGCATCCGGCCATCAAATATGATCTGGTATGGTCCATCTTTGGGCTGCGCATGCAAATGATGCTGCTGAGC
GAGAGCCGCGAAGTCGTCGCCGCCGGCTATCGAGCCACCAGATACGCAATAACGGACGTGGCATCGCTCAAGAAG
ATCCGTAGCCTCAACGTTGACTACTTGGTCATTAGGTCTCTGAACAACTACCGCAAGGCCGATGTTGAGCGCGAG
CAAGCCCTCAAGTTCGTCCGAGCCTTTCTCGATGTCAAGGACGGCGTCAGGCAGGTTTCCCGCGCCGTAGTGCGC
ACCATCGTCGCCGTCGCCGAGCAGAGCGAAGACCGACGGCCCGGCGTGCAGGTCGCCGACCACAATATCGACCGG
TTGCGGCCGATATGCATAGAGACGCTTGCCGAGATCATGGTACAGGACCCGCGTCTACTCGTCGCGTCAGGAGGT
CTCGGGCCGCTCTGCGACGCCCTGGCCGAGGGCACCTACAAGGCACCGGAGAGCCTCGTGTCGTCCTTTCTCTAC
CTGCTCGACACGCCCGGCCGCCGCGGGTACATGCAGCCCGGCTATGGTCTGGAAATGGTCTTTACCGCCTTCACC
GACCAGCTCGCGAGCGCCGAAAGCATACTCAAGCAGAATTCGCGGGCCATCTCCGTCGCCTTGAAGTCGTGGTCC
GGTCTCATGGCCCTCTGCATGTACGACTTCCGCTCGATCCGCTCCCTCATCGCGAGCATCCTCTTCCCCAACCCC
GCCATTCGCGAGACCGTCCTCGACCTGTTCTTCTCCCTTTTGCGGATCAAGCCGCCCGCATGGGCGACGTCCTTT
CTGGCGGGGCGGAGGTTGACGACGTATGGCAGAGTGGCCAATATGAAGTCGACCAGCGGCAGGGAGCGAAGCGCC
ACGCTCTCTCACGAAGAGGACACGGGCGAGCAAAACTTCGTCGACCACTACACGGCGCTGCTGCTGGCTGTCTTT
ATCAGGGCCGGCCTGCTGCAGAGCCTGCTGCGGATCGCGCAGTCGGAAGAGGAACCCACGCTGAAGCGCAAGACG
ACGCTGCTGATAGGGGAGGTACTGAAGTTGGCCAGCCGGCTGCTGCCCCCGTCGTGGAGCGCCGAGCTTCAGCTC
TTACCGGAGCTGTTCGCGGCGGCCGCGCAGTTTGGCAACGAGTCGCACTTCGTCGCGTCGGGCATCGTGTATCAG
ATCAGCAGCGTCAGCAGGACTCTGTATCGGAGCGCTCCATCCGAGTCCATGGGCGGTACCCTTCCGTCGAGCGAC
AGCATGCAGAACCTGTTGATGATGGAGGAGCATCCCAAGGCCAACGCTGCCGTGGTGTTCGACGACGCCACGTTC
CGCCAGCTTCTCCTTGACACGGGGGTGCTCAATAGCTCCAACTACTTGAAGTGGAACTGGGATGTCATTGTCAAG
GTCATAGACGGGCCGCTGCAGATCGGGAAGCGGTTGGAGGAGGCCATTAAGGCGTCCAAGTTTATGAAGCGCATC
ATGAGCTTTTACAGGCCGTTCAAGTACAAGTTTGCGGAAATCAGGAGCACGCGCAATACTCACAAGTATGTCAAG
GCCGGTTGCGCGTTGGTACACTCCCTCCTCCAATCCCCAGAGGGCATCAGGGTCCTGGCGGATAGCAAGCTGCTG
AGGCAGATTGCCGAGTGCCTGGCCCAGTGCGATCCGACCAGCGGGCTCACGGCCCAGTTCCCTATGTTCGCCAAG
GATCGACTTACCGACACGCTCTGTGGAGGCTATTTCCCGATGCTTGGCGTCCTCAGCAGCGACGCCAATGGGCTT
CTCCTTCTCGAGAGGTGGAGGATGTTCAACATGATGTACCACATCGTCGACCTGAAGCAGCGACCCGATCTCATC
AAGCTCCTCCTGTCCAACTTTGACTACAGCCTCCAGGGACACCCTCGCGTTCTACTATCCAAGGCTCTGGTCGCG
GGCACCAAGGAGATCCGGATTCATGCGACGAACACGCTGCGAAAGTGCACCATGCGGCCCATCTCTTCGCTGGGC
GGTCAGGGCAACGCCAGCGACTCCAAGTGGGCCATTAAGCTTCTCGTGACGCAGCTGTACGACCCAGAGATTGAG
GTCTGCTCGACTGCCGTCAAGATCCTGGAGAACGCGTGTAACCGGAAGACGTTTCTCGAATACATTGTCGAGTGT
CGACCGGCGTTGGACCACCTGGGCGAAATCGGAGCGCCGCTACTGCTGCGATTCCTGTCGACGTCGATCGGATAC
CACTACCTAGACGGGCTGGACTACATCAGCAACGAGATGGACGACTGGTTTCTCGGTCGAAACGACTCGTATGTC
GGCGTCATCGAGGCCAGCCTGGCGAGGGCTTTCCTGGCGAGACCGGACGACCACAGCCACCGCGGCAGCATGTTT
GACGAGACGGAAGCCGAGACGGACTACCACGACAGCCACGTACCGCCGCACTTTTACCGGGAGCTGACGCGCACG
CGCGAAGGCTGCAAGCTGCTGAGCGACAAGGGCCACTTTGACGAGTTTGCGGCGACGATCCGCGACCACGGGATG
CAGACGGAGGATGGCGAGCTGATGACCAAGGTCAAGGGCTGTCTCTGGGCCGTGGGCAATGTCGGCTCGATGGAG
CTGGGCGCGCCGTTTCTGGAATCGAGCGACGTGGTGCAGCGCATTGTACGCGTGGCCGAGTCACACGAGGTCATG
AGTCTGCGCGGCACCGCCTTTTTCGTGCTGGGTCTCATCTCGCGCTCGACACACGGCCTGGAGATCCTCTCGGAG
CATGGGTGGGACGCGAACACGACGCCGATGGGGGCATCGCTCGGCCTCTGCATCCCCAACGAGCTGTCCAAGCTC
TTCTCGATTCAGCCGTGGAAGCACGTCAAGGCGGCGTCCATTACGCTACTCGATACGCAGCGGACGATAAAGGAG
CAGCCTCCGGTGCGACAGGCGCGGCCACCGCTGGCGCCGTCGGAGATGCCGCCGCTGTTGAGCGAGGCGGACGTC
AACGAGCGCATCATGGAGCTCATCGTCGACCTAGGCAACATGGTGCTATATAAAAAGGCGCTGACGGACCTGCAG
CGGGTCAAGCAGCGCAAGCCCAAGGCGTTCCGCAGCGTCGATTTCTTCAAGAAGGTCATGGGCCTGATGGAGTGG
AACCACTACCGGCTCGGGGTGCGACGGCTGGTGATTGACCTGTTTGAGAAGAACGTGATGCGGCAGGTCGTCTTT
GGCGACGACGAGGGCGACGGCGGAGCGGGCGTGGGAGCGACAGGTGACGGCGGCGAAGACAGCAGCGAGGGAGAC
GATCGGACGGAGAGGCAAAGGAGCATCAGCGAGCCAGCCGATATGCCCTCGGACCTGGTGCCTGCGCCTCTCCAG
CTGCGGCGATAG
Gene >Ophio5|4949
ATGATCATGCCCCCCTCATCCTCCCAGCAAAACTCCCTCTATCATCAGCAGCAAACCGGCCGCACCAGCTTCGAC
CGCGATGGCGCCGCTCTGCAGCCTCCCAACGGCAGCCAGTCCCGCAAACTGTCCGCCTCTGCTATATCCTTCGCG
CCCCGCGGCAGCAGCCTCAATCCCAACCCGGGTGTCGGCAGCTTCAGCTCCGACCTGCGAAACCAAACAATGTCC
AGCCGCGCCGGCAGTCGCGCAGAGGCTGGATCCATGTATCCCAGCAGCTTCACGGATAAGGTCGAGGAAGACGAT
GCGGCGGCGGCGGCAGAACAAGCCCTAGCCGTGCTCAAGGACAAGCTGAACCGCGAGATGAAGATCAAGGAAGGC
AGCGAAAACATGCTCGAGGCGCTCAACATAAAAAAGGCCAAGCAGACCAAGGAGCAGCGTCAAAGGGTCGAGGCG
GAGCTGAGCGCGAGCAACGCCAGGATCAAGGAGCTCCGGCAAAAGATAGCTGATGCCCAGCGCTCGAAAGCTCTT
CCTCCGGCAACGCCCACCAGGAGTCGGAACCAGGATGGTTTGTTGCAGTCCAACGGTCTGCTGCGCTCGCCACCG
AGCATCTCACGATCGGCAATTGGTTCAGATATTGACGAGATGTTAGAGAGCCCGACCTTCCTTCTGGCCGAGCTC
CTGCAGGCGCTCGAGGTAGAGGGCATGCCGCCAGAGTACTACGTCAGCCGTGCCAACCAGCTCGTCGAGCTATTC
AAAAGGCATCCGGCCATCAAATATGATCTGGTATGGTCCATCTTTGGGCTGCGCATGCAAATGATGCTGCTGAGC
GAGAGCCGCGAAGTCGTCGCCGCCGGCTATCGAGCCACCAGATACGCAATAACGGACGTGGCATCGCTCAAGAAG
ATCCGTAGCCTCAACGTTGACTACTTGGTCATTAGGTGACTCTACATCTTCCCACAGACATATGAGCCCGACCGC
TGACGCTCTCAGGTCTCTGAACAACTACCGCAAGGCCGATGTTGAGCGCGAGCAAGCCCTCAAGTTCGTCCGAGC
CTTTCTCGATGTCAAGGACGGCGTCAGGCAGGTTTCCCGCGCCGTAGTGCGCACCATCGTCGCCGTCGCCGAGCA
GAGCGAAGACCGACGGCCCGGCGTGCAGGTCGCCGACCACAATATCGACCGGTTGCGGCCGATATGCATAGAGAC
GCTTGCCGAGATCATGGTACAGGACCCGCGTCTACTCGTCGCGTCAGGAGGTCTCGGGCCGCTCTGCGACGCCCT
GGCCGAGGGCACCTACAAGGCACCGGAGAGCCTCGTGTCGTCCTTTCTCTACCTGCTCGACACGCCCGGCCGCCG
CGGGTACATGCAGCCCGGCTATGGTCTGGAAATGGTCTTTACCGCCTTCACCGACCAGCTCGCGAGCGCCGAAAG
CATACTCAAGCAGAATTCGCGGGCCATCTCCGTCGCCTTGAAGTCGTGGTCCGGTCTCATGGCCCTCTGCATGTA
CGACTTCCGCTCGATCCGCTCCCTCATCGCGAGCATCCTCTTCCCCAACCCCGCCATTCGCGAGACCGTCCTCGA
CCTGTTCTTCTCCCTTTTGCGGATCAAGCCGCCCGCATGGGCGACGTCCTTTCTGGCGGGGCGGAGGTTGACGAC
GTATGGCAGAGTGGCCAATATGAAGTCGACCAGCGGCAGGGAGCGAAGCGCCACGCTCTCTCACGAAGAGGACAC
GGGCGAGCAAAACTTCGTCGACCACTACACGGCGCTGCTGCTGGCTGTCTTTATCAGGGCCGGCCTGCTGCAGAG
CCTGCTGCGGATCGCGCAGTCGGAAGAGGAACCCACGCTGAAGCGCAAGACGACGCTGCTGATAGGGGAGGTACT
GAAGTTGGCCAGCCGGCTGCTGCCCCCGTCGTGGAGCGCCGAGCTTCAGCTCTTACCGGAGCTGTTCGCGGCGGC
CGCGCAGTTTGGCAACGAGTCGCACTTCGTCGCGTCGGGCATCGTGTATCAGATCAGCAGCGTCAGCAGGACTCT
GTATCGGAGCGCTCCATCCGAGTCCATGGGCGGTACCCTTCCGTCGAGCGACAGCATGCAGAACCTGTTGATGAT
GGAGGAGCATCCCAAGGCCAACGCTGCCGTGGTGTTCGACGACGCCACGTTCCGCCAGCTTCTCCTTGACACGGG
GGTGCTCAATAGCTCCAACTACTTGAAGTGGAACTGGGATGTCATTGTCAAGGTCATAGACGGGCCGCTGCAGAT
CGGGAAGCGGTTGGAGGAGGCCATTAAGGCGTCCAAGTTTATGAAGCGCATCATGAGCTTTTACAGGCCGTTCAA
GTACAAGTTTGCGGAAATCAGGAGCACGCGCAATACTCACAAGTATGTCAAGGCCGGTTGCGCGTTGGTACACTC
CCTCCTCCAATCCCCAGAGGGCATCAGGGTCCTGGCGGATAGCAAGCTGCTGAGGCAGATTGCCGAGTGCCTGGC
CCAGTGCGATCCGGCAAGTTCAACTCCTCTACCCGGCGGATGCGAGGGTGAGAGTGAGGAGCAGCTGCTGACAGA
CGGGCAGACCAGCGGGCTCACGGCCCAGTTCCCTATGTTCGCCAAGGATCGACTTACCGACACGCTCTGTGGAGG
CTATTTCCCGATGCTTGGCGTCCTCAGCAGCGACGCCAATGGGCTTCTCCTTCTCGAGAGGTGGAGGATGTTCAA
CATGATGTACCACATCGTCGACCTGAAGCAGCGACCCGATCTCATCAAGCTCCTCCTGTCCAACTTTGACTACAG
CCTCCAGGGACACCCTCGCGTTCTACTATCCAAGGCTCTGGTCGCGGGCACCAAGGAGATCCGGATTCATGCGAC
GAACACGCTGCGAAAGTGCACCATGCGGCCCATCTCTTCGCTGGGCGGTCAGGGCAACGCCAGCGACTCCAAGTG
GGCCATTAAGCTTCTCGTGACGCAGCTGTACGACCCAGAGATTGAGGTCTGCTCGACTGCCGTCAAGATCCTGGA
GAACGCGTGTAACCGGAAGACGTTTCTCGAATACATTGTCGAGTGTCGACCGGCGTTGGACCACCTGGGCGAAAT
CGGAGCGCCGCTACTGCTGCGATTCCTGTCGACGTCGATCGGATACCACTACCTAGACGGGCTGGACTACATCAG
CAACGAGATGGACGACTGGTTTCTCGGTCGAAACGACTCGTATGTCGGCGTCATCGAGGCCAGCCTGGCGAGGGC
TTTCCTGGCGAGACCGGACGACCACAGCCACCGCGGCAGCATGTTTGACGAGACGGAAGCCGAGACGGACTACCA
CGACAGCCACGTACCGCCGCACTTTTACCGGGAGCTGACGCGCACGCGCGAAGGCTGCAAGCTGCTGAGCGACAA
GGGCCACTTTGACGAGTTTGCGGCGACGATCCGCGACCACGGGATGCAGACGGAGGATGGCGAGCTGATGACCAA
GGTCAAGGGCTGTCTCTGGGCCGTGGGCAATGTCGGCTCGATGGAGCTGGGCGCGCCGTTTCTGGAATCGAGCGA
CGTGGTGCAGCGCATTGTACGCGTGGCCGAGTCACACGAGGTCATGAGTCTGCGCGGCACCGCCTTTTTCGTGCT
GGGTCTCATCTCGCGCTCGACACACGGCCTGGAGATCCTCTCGGAGCATGGGTGGGACGCGAACACGACGCCGAT
GGGGGCATCGCTCGGCCTCTGCATCCCCAACGAGCTGTCCAAGCTCTTCTCGATTCAGCCGTGGAAGCACGTCAA
GGCGGCGTCCATTACGCTACTCGATACGCAGCGGACGATAAAGGAGCAGCCTCCGGTGCGACAGGCGCGGCCACC
GCTGGCGCCGTCGGAGATGCCGCCGCTGTTGAGCGAGGCGGACGTCAACGAGCGCATCATGGAGCTCATCGTCGA
CCTAGGCAACATGGTGCTATATAAAAAGGCGCTGACGGACCTGCAGCGGGTCAAGCAGCGCAAGCCCAAGGCGTT
CCGCAGCGTCGATTTCTTCAAGAAGGTCATGGGCCTGATGGAGTGGAACCACTACCGGCTCGGGGTGCGACGGCT
GGTGATTGACCTGTTTGAGAAGAACGTGATGCGGCAGGTCGTCTTTGGCGACGACGAGGGCGACGGCGGAGCGGG
CGTGGGAGCGACAGGTGACGGCGGCGAAGACAGCAGCGAGGGAGACGATCGGACGGAGAGGCAAAGGAGCATCAG
CGAGCCAGCCGATATGCCCTCGGACCTGGTGCCTGCGCCTCTCCAGCTGCGGCGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail