Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4947
Gene name
Locationscaffold_4:9270..11316
Strand+
Gene length (bp)2046
Transcript length (bp)1881
Coding sequence length (bp)1878
Protein length (aa) 626

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 296 315 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 43.95 24.17 63.73
CcL In ants, during behavior modification 43.46 22.71 64.22
CcD In ants, recently dead 40.73 21.41 60.05

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.969653 no
SC16a CcD 0.784992 no
CcL CcD 0.823619 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4947
MNTATSFFMVPAGMLGAPTQSQPVPSGPVVFPPWTRDDEDEDKIRHVELKRHWNTKRDSSPAARGSDSKSRPSVK
TGDSENHGYGLSTTADDSDDSDDSDDDQQEHSAGSSPDSKQAPDPLGLPSPKSRPTPLPMPKNKLDTTPTRTIDP
TLGPLTTLGKGLLPGAVNKADDDDSDNRDEHNEQDNFDKIDEHDEHDEPFFFTNNPNSPPQSPRFPDIGASYPIV
TMPAALDPSHDGFSFPESTAERKGLQPVVTVTESASSSRTPAAADSMQTPDHEVVQAPAHHHGLDADAEKALVAV
GAVGATIIVFFVAWFGWKCYKMHRRSGQSKDWQHHHTPSMSLDNIGQPGGTSRRSGFLGLERPKQFMMNLASRVP
ILKERVAMRSWSNLDKQHDDAVWAEKRLPVFSQDSHRRNSNGITVHTAIMTKSERGNESTTWSLPHQAPSQQFRP
TPRSNNTLSGISDASSLSSGFGDGDIIMPPAVTGMATTTTVTAVAVPAPVARRSSLSTASRNYRDTVYTEATEAT
EASEDTVPRFRTINSWVRQQSGRIKRARQRDSDAPPLPNPPPEQDFRMMMPDNEEPRRVVESGYGVAESDIIAGY
GATEAASQSGYGVVETDRPRGYGIAG
Coding >Ophio5|4947
ATGAACACTGCTACTTCTTTTTTTATGGTTCCAGCCGGGATGCTCGGGGCTCCTACCCAGAGCCAGCCTGTACCA
TCCGGGCCCGTGGTCTTTCCGCCCTGGACGAGAGACGACGAAGACGAGGATAAGATCCGCCATGTCGAATTAAAG
CGACATTGGAATACCAAACGCGACTCGAGCCCGGCCGCCCGAGGAAGCGACTCTAAGTCTCGGCCATCCGTAAAG
ACGGGAGATTCAGAGAACCATGGTTATGGCTTGTCCACCACCGCCGACGACAGCGACGACAGCGACGACAGCGAC
GACGATCAGCAGGAGCATTCAGCTGGCAGTTCCCCTGATTCGAAGCAGGCTCCCGATCCTCTGGGCCTCCCCTCA
CCGAAGTCACGACCGACGCCACTACCAATGCCCAAGAACAAGCTGGACACTACGCCTACAAGAACCATTGACCCG
ACTCTGGGTCCCCTCACTACGCTCGGCAAGGGTTTGTTGCCTGGTGCCGTCAATAAAGCAGATGATGACGATTCC
GACAATCGTGACGAGCACAACGAGCAAGACAATTTTGATAAAATTGACGAGCACGATGAGCACGACGAACCCTTC
TTCTTTACAAATAACCCGAATAGTCCTCCACAAAGCCCGCGCTTCCCGGATATCGGGGCATCATATCCCATTGTG
ACTATGCCCGCGGCCCTGGATCCATCCCATGACGGCTTTTCATTCCCAGAGTCGACGGCGGAAAGGAAAGGTTTA
CAGCCTGTTGTCACCGTCACAGAGTCGGCATCGTCGAGTCGCACACCGGCTGCGGCCGACTCGATGCAAACCCCT
GATCACGAGGTAGTGCAGGCACCAGCTCACCATCATGGCCTTGACGCGGACGCAGAGAAGGCTCTTGTTGCCGTC
GGCGCAGTTGGTGCTACCATCATCGTGTTCTTCGTCGCCTGGTTTGGCTGGAAATGCTACAAAATGCACAGAAGA
TCAGGTCAGTCGAAGGACTGGCAGCATCATCATACGCCGTCCATGTCGCTGGACAACATCGGGCAGCCTGGCGGG
ACCAGCCGGAGAAGCGGCTTCCTAGGTCTGGAGCGGCCCAAGCAGTTCATGATGAACTTAGCCTCGCGCGTGCCC
ATCCTTAAGGAGCGAGTCGCCATGCGGAGCTGGTCCAACCTCGACAAGCAGCACGACGACGCCGTCTGGGCAGAG
AAGCGGCTCCCCGTTTTTAGCCAGGACAGCCACCGGCGCAACTCGAACGGCATCACCGTCCACACGGCCATCATG
ACCAAGAGCGAGCGCGGCAACGAGAGCACCACCTGGAGTCTGCCTCACCAGGCGCCCAGCCAGCAGTTCCGGCCG
ACGCCGCGGTCCAATAACACGCTTTCCGGCATCAGCGACGCGTCGTCGTTGTCTTCCGGTTTCGGCGACGGCGAT
ATCATCATGCCGCCGGCGGTGACGGGCATGGCCACTACCACGACCGTCACCGCTGTGGCGGTCCCGGCGCCCGTC
GCCCGCCGATCGAGCCTCAGCACCGCGTCTCGCAATTACCGTGACACCGTTTATACCGAGGCCACCGAGGCCACC
GAGGCGTCAGAGGACACGGTACCGCGCTTCCGCACCATCAACTCGTGGGTCCGCCAGCAGTCGGGCCGCATCAAG
CGAGCCAGGCAGCGCGACAGCGACGCGCCCCCCCTGCCCAACCCGCCGCCGGAGCAGGACTTTCGCATGATGATG
CCGGACAATGAAGAGCCGCGGCGGGTCGTTGAGTCGGGGTACGGCGTCGCCGAGTCGGACATTATAGCGGGCTAC
GGTGCCACCGAGGCGGCTAGTCAGTCGGGATACGGCGTGGTAGAGACGGACCGTCCTAGGGGGTATGGTATAGCA
GGA
Transcript >Ophio5|4947
ATGAACACTGCTACTTCTTTTTTTATGGTTCCAGCCGGGATGCTCGGGGCTCCTACCCAGAGCCAGCCTGTACCA
TCCGGGCCCGTGGTCTTTCCGCCCTGGACGAGAGACGACGAAGACGAGGATAAGATCCGCCATGTCGAATTAAAG
CGACATTGGAATACCAAACGCGACTCGAGCCCGGCCGCCCGAGGAAGCGACTCTAAGTCTCGGCCATCCGTAAAG
ACGGGAGATTCAGAGAACCATGGTTATGGCTTGTCCACCACCGCCGACGACAGCGACGACAGCGACGACAGCGAC
GACGATCAGCAGGAGCATTCAGCTGGCAGTTCCCCTGATTCGAAGCAGGCTCCCGATCCTCTGGGCCTCCCCTCA
CCGAAGTCACGACCGACGCCACTACCAATGCCCAAGAACAAGCTGGACACTACGCCTACAAGAACCATTGACCCG
ACTCTGGGTCCCCTCACTACGCTCGGCAAGGGTTTGTTGCCTGGTGCCGTCAATAAAGCAGATGATGACGATTCC
GACAATCGTGACGAGCACAACGAGCAAGACAATTTTGATAAAATTGACGAGCACGATGAGCACGACGAACCCTTC
TTCTTTACAAATAACCCGAATAGTCCTCCACAAAGCCCGCGCTTCCCGGATATCGGGGCATCATATCCCATTGTG
ACTATGCCCGCGGCCCTGGATCCATCCCATGACGGCTTTTCATTCCCAGAGTCGACGGCGGAAAGGAAAGGTTTA
CAGCCTGTTGTCACCGTCACAGAGTCGGCATCGTCGAGTCGCACACCGGCTGCGGCCGACTCGATGCAAACCCCT
GATCACGAGGTAGTGCAGGCACCAGCTCACCATCATGGCCTTGACGCGGACGCAGAGAAGGCTCTTGTTGCCGTC
GGCGCAGTTGGTGCTACCATCATCGTGTTCTTCGTCGCCTGGTTTGGCTGGAAATGCTACAAAATGCACAGAAGA
TCAGGTCAGTCGAAGGACTGGCAGCATCATCATACGCCGTCCATGTCGCTGGACAACATCGGGCAGCCTGGCGGG
ACCAGCCGGAGAAGCGGCTTCCTAGGTCTGGAGCGGCCCAAGCAGTTCATGATGAACTTAGCCTCGCGCGTGCCC
ATCCTTAAGGAGCGAGTCGCCATGCGGAGCTGGTCCAACCTCGACAAGCAGCACGACGACGCCGTCTGGGCAGAG
AAGCGGCTCCCCGTTTTTAGCCAGGACAGCCACCGGCGCAACTCGAACGGCATCACCGTCCACACGGCCATCATG
ACCAAGAGCGAGCGCGGCAACGAGAGCACCACCTGGAGTCTGCCTCACCAGGCGCCCAGCCAGCAGTTCCGGCCG
ACGCCGCGGTCCAATAACACGCTTTCCGGCATCAGCGACGCGTCGTCGTTGTCTTCCGGTTTCGGCGACGGCGAT
ATCATCATGCCGCCGGCGGTGACGGGCATGGCCACTACCACGACCGTCACCGCTGTGGCGGTCCCGGCGCCCGTC
GCCCGCCGATCGAGCCTCAGCACCGCGTCTCGCAATTACCGTGACACCGTTTATACCGAGGCCACCGAGGCCACC
GAGGCGTCAGAGGACACGGTACCGCGCTTCCGCACCATCAACTCGTGGGTCCGCCAGCAGTCGGGCCGCATCAAG
CGAGCCAGGCAGCGCGACAGCGACGCGCCCCCCCTGCCCAACCCGCCGCCGGAGCAGGACTTTCGCATGATGATG
CCGGACAATGAAGAGCCGCGGCGGGTCGTTGAGTCGGGGTACGGCGTCGCCGAGTCGGACATTATAGCGGGCTAC
GGTGCCACCGAGGCGGCTAGTCAGTCGGGATACGGCGTGGTAGAGACGGACCGTCCTAGGGGGTATGGTATAGCA
GGATGA
Gene >Ophio5|4947
ATGAACACTGCTACTTCTTTTTGTGCGCCACCACACTCCCACCAGGCGTTTCCCAACGCTCACTGGCGGTGCTAT
CAGTTATGGTTCCAGCCGGGATGCTCGGGGCTCCTACCCAGAGCCAGCCTGTACCATCCGGGCCCGTGGTCTTTC
CGCCCTGGACGAGAGACGACGAAGACGAGGATAAGATCCGCCATGTCGAATTAAAGCGACATTGGAATACCAAAC
GCGACTCGAGCCCGGCCGCCCGAGGAAGCGACTCTAAGTCTCGGCCATCCGTAAAGACGGGAGATTCAGAGAACC
ATGGTTATGGCTTGTCCACCACCGCCGACGACAGCGACGACAGCGACGACAGCGACGACGATCAGCAGGAGCATT
CAGCTGGCAGTTCCCCTGATTCGAAGCAGGCTCCCGATCCTCTGGGCCTCCCCTCACCGAAGTCACGACCGACGC
CACTACCAATGCCCAAGAACAAGCTGGACACTACGCCTACAAGAACCATTGACCCGACTCTGGGTCCCCTCACTA
CGCTCGGCAAGGGTTTGTTGGTAAGTAGGCCGCGAAAATGGTTTTAAATTTGACTCTAACCAGACGCAGCCTGGT
GCCGTCAATAAAGCAGATGATGACGATTCCGACAATCGTGACGAGCACAACGAGCAAGACAATTTTGATAAAATT
GACGAGCACGATGAGCACGACGAACCCTTCTTCTTTACAAATAACCCGAATAGTCCTCCACAAAGCCCGCGCTTC
CCGGATATCGGGGCATCATATCCCATTGTGACTATGCCCGCGGCCCTGGATCCATCCCATGACGGCTTTTCATTC
CCAGAGTCGACGGCGGAAAGGAAAGGTTTACAGCCTGTTGTCACCGTCACAGAGTCGGCATCGTCGAGTCGCACA
CCGGCTGCGGCCGACTCGATGCAAACCCCTGATCACGAGGTAGTGCAGGCACCAGCTCACCATCATGGCCTTGAC
GCGGACGCAGAGAAGGCTCTTGTTGCCGTCGGCGCAGTTGGTATGTGATGTGGCTCCTGATGGAAAGTCGCGTGT
GCTGCCTGCTGACGATAGCAATTAGGTGCTACCATCATCGTGTTCTTCGTCGCCTGGTTTGGCTGGAAATGCTAC
AAAATGCACAGAAGATCAGGTCAGTCGAAGGACTGGCAGCATCATCATACGCCGTCCATGTCGCTGGACAACATC
GGGCAGCCTGGCGGGACCAGCCGGAGAAGCGGCTTCCTAGGTCTGGAGCGGCCCAAGCAGTTCATGATGAACTTA
GCCTCGCGCGTGCCCATCCTTAAGGAGCGAGTCGCCATGCGGAGCTGGTCCAACCTCGACAAGCAGCACGACGAC
GCCGTCTGGGCAGAGAAGCGGCTCCCCGTTTTTAGCCAGGACAGCCACCGGCGCAACTCGAACGGCATCACCGTC
CACACGGCCATCATGACCAAGAGCGAGCGCGGCAACGAGAGCACCACCTGGAGTCTGCCTCACCAGGCGCCCAGC
CAGCAGTTCCGGCCGACGCCGCGGTCCAATAACACGCTTTCCGGCATCAGCGACGCGTCGTCGTTGTCTTCCGGT
TTCGGCGACGGCGATATCATCATGCCGCCGGCGGTGACGGGCATGGCCACTACCACGACCGTCACCGCTGTGGCG
GTCCCGGCGCCCGTCGCCCGCCGATCGAGCCTCAGCACCGCGTCTCGCAATTACCGTGACACCGTTTATACCGAG
GCCACCGAGGCCACCGAGGCGTCAGAGGACACGGTACCGCGCTTCCGCACCATCAACTCGTGGGTCCGCCAGCAG
TCGGGCCGCATCAAGCGAGCCAGGCAGCGCGACAGCGACGCGCCCCCCCTGCCCAACCCGCCGCCGGAGCAGGAC
TTTCGCATGATGATGCCGGACAATGAAGAGCCGCGGCGGGTCGTTGAGTCGGGGTACGGCGTCGCCGAGTCGGAC
ATTATAGCGGGCTACGGTGCCACCGAGGCGGCTAGTCAGTCGGGATACGGCGTGGTAGAGACGGACCGTCCTAGG
GGGTATGGTATAGCAGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail