Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4939
Gene name
Locationscaffold_399:6520..7254
Strand-
Gene length (bp)734
Transcript length (bp)567
Coding sequence length (bp)564
Protein length (aa) 188

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13664 DUF4149 Domain of unknown function (DUF4149) 3.7E-25 15 124

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q06089|YP098_YEAST Uncharacterized mitochondrial outer membrane protein YPR098C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR098C PE=1 SV=2 13 176 2.0E-19

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 53 75 22
3 95 117 22
4 154 176 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4939
MAESIIFSVAPYHIVSYGTLLGASVFHSFINGPVMYKSIDRPAFSAAQQSLFPIYFGLQTALPAVLALTFPGSTL
AGVPSSVSGLLDASSRWDSLVPIATMFVTGVVNLTVLLPATVKTMKERRGQCKRDGKEWDAEGPHSEEMKALNKR
FGMLHGISSLINLVTVMSAVSYGFTLGARMQSLADRIG
Coding >Ophio5|4939
ATGGCAGAATCAATCATCTTCTCCGTGGCCCCGTACCACATCGTATCCTACGGGACCCTGCTGGGAGCGTCGGTC
TTTCACTCGTTCATCAATGGACCCGTCATGTACAAGTCCATCGACAGGCCGGCCTTCTCCGCCGCTCAGCAGAGC
CTGTTCCCCATCTACTTTGGCCTGCAAACGGCCCTACCGGCCGTGCTCGCACTCACATTCCCTGGAAGCACGCTC
GCTGGCGTGCCGAGTAGCGTGTCCGGACTGCTGGATGCGTCGTCGCGGTGGGACTCGCTGGTGCCGATAGCGACC
ATGTTCGTCACGGGCGTCGTCAACCTGACCGTCCTGCTTCCGGCGACTGTGAAGACGATGAAGGAGCGTCGAGGA
CAGTGTAAGCGAGACGGCAAGGAGTGGGATGCCGAGGGACCTCATTCGGAGGAGATGAAGGCGCTGAATAAGAGG
TTCGGCATGCTGCATGGCATCTCTTCCCTCATCAACCTCGTGACTGTCATGTCAGCTGTGAGCTATGGCTTTACT
CTCGGTGCGCGGATGCAGTCCTTGGCGGATAGGATTGGC
Transcript >Ophio5|4939
ATGGCAGAATCAATCATCTTCTCCGTGGCCCCGTACCACATCGTATCCTACGGGACCCTGCTGGGAGCGTCGGTC
TTTCACTCGTTCATCAATGGACCCGTCATGTACAAGTCCATCGACAGGCCGGCCTTCTCCGCCGCTCAGCAGAGC
CTGTTCCCCATCTACTTTGGCCTGCAAACGGCCCTACCGGCCGTGCTCGCACTCACATTCCCTGGAAGCACGCTC
GCTGGCGTGCCGAGTAGCGTGTCCGGACTGCTGGATGCGTCGTCGCGGTGGGACTCGCTGGTGCCGATAGCGACC
ATGTTCGTCACGGGCGTCGTCAACCTGACCGTCCTGCTTCCGGCGACTGTGAAGACGATGAAGGAGCGTCGAGGA
CAGTGTAAGCGAGACGGCAAGGAGTGGGATGCCGAGGGACCTCATTCGGAGGAGATGAAGGCGCTGAATAAGAGG
TTCGGCATGCTGCATGGCATCTCTTCCCTCATCAACCTCGTGACTGTCATGTCAGCTGTGAGCTATGGCTTTACT
CTCGGTGCGCGGATGCAGTCCTTGGCGGATAGGATTGGCTGA
Gene >Ophio5|4939
ATGGCAGAATCAATCATCTTCTCCGTGGCCCCGTACCACATCGTATCGTATGTCCATCAGAGTTCGACATCGGGC
TTAGCTGACATGTGCCTCAGCTACGGGACCCTGCTGGGAGCGTCGGTCTTTCACGTACGTATCCCGCCGTGAGTT
GATATCCAATTGGCAAATGGCTAATGCCACAAACGAAAGTCGTTCATCAATGGACCCGTCATGTACAAGTCCATC
GACAGGCCGGCCTTCTCCGCCGCTCAGCAGAGCCTGTTCCCCATCTACTTTGGCCTGCAAACGGCCCTACCGGCC
GTGCTCGCACTCACATTCCCTGGAAGCACGCTCGCTGGCGTGCCGAGTAGCGTGTCCGGACTGCTGGATGCGTCG
TCGCGGTGGGACTCGCTGGTGCCGATAGCGACCATGTTCGTCACGGGCGTCGTCAACCTGACCGTCCTGCTTCCG
GCGACTGTGAAGACGATGAAGGAGCGTCGAGGACAGTGTATGCTTTTTTTCTCTTTCTTTTCTTTCTGTCGACTC
GTTCTGGCTGACTGGTGGCAGGTAAGCGAGACGGCAAGGAGTGGGATGCCGAGGGACCTCATTCGGAGGAGATGA
AGGCGCTGAATAAGAGGTTCGGCATGCTGCATGGCATCTCTTCCCTCATCAACCTCGTGACTGTCATGTCAGCTG
TGAGCTATGGCTTTACTCTCGGTGCGCGGATGCAGTCCTTGGCGGATAGGATTGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail