Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4937
Gene name
Locationscaffold_399:3635..4885
Strand+
Gene length (bp)1250
Transcript length (bp)1071
Coding sequence length (bp)1068
Protein length (aa) 356

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06966 DUF1295 Protein of unknown function (DUF1295) 5.2E-36 68 319

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74507|YJD4_SCHPO Uncharacterized protein C594.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC594.04c PE=3 SV=2 3 324 4.0E-56

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 52 69 17
2 82 101 19
3 160 182 22
4 189 211 22
5 278 300 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4937
MHLPALRSLRDCGDYALTVKPFIPQLYALPERIAGIRSLDGLNQLYAETNPLMSAFAASIVLGGVFLVASEINRN
YSQVDRFWSILPNLYVIHLAVWARLADIPHSRVDLVAVVTTIWSCRLTFNYWRRGGYEIGSEDYRWEIVKSRTHP
LAFFVLNVTFISFIQSVLLFSFSCLPAYVILLSSRFQPHVSAADVGYFSVLVLLVLSEWMSDGQQWTYQTAKRQY
QKDAKLPKGWHQSDLDRGFITSGLWAYSRHPNFLAEQAIWFILYNWGCHATDTLYNWSFVGCASLILLFQGSTFL
TESITAGKYSEYAEYQRQVGMFMPMSFRGYQPTANKPRVIRSSDLAKRQEETRKQK
Coding >Ophio5|4937
ATGCATCTCCCCGCCCTCAGGTCCCTTCGTGACTGCGGCGACTACGCCCTGACGGTAAAGCCCTTCATTCCCCAG
CTGTACGCGCTACCGGAGCGGATAGCCGGCATCAGGAGCCTCGATGGCCTCAACCAGCTCTACGCCGAAACGAAC
CCGCTCATGTCGGCCTTTGCCGCTTCCATCGTGCTCGGGGGCGTTTTCCTCGTCGCCTCCGAGATCAACAGAAAC
TACTCTCAGGTCGACCGCTTCTGGAGCATCTTGCCAAACCTCTACGTCATACATCTGGCTGTCTGGGCCCGTCTT
GCCGACATCCCTCATAGCCGTGTCGACCTGGTCGCCGTCGTCACTACCATCTGGAGCTGTCGCTTGACCTTCAAT
TACTGGCGTCGAGGCGGCTATGAAATCGGCTCCGAGGACTACAGATGGGAAATCGTCAAGTCCCGAACCCACCCT
CTCGCCTTCTTCGTCCTCAACGTCACCTTCATCTCCTTCATCCAGAGCGTGCTATTGTTCAGCTTCTCCTGCCTC
CCCGCCTACGTCATCCTTCTGTCATCGCGCTTCCAGCCGCACGTCTCTGCAGCCGACGTCGGCTACTTTTCCGTC
CTGGTCCTGCTCGTGCTTAGTGAATGGATGAGCGATGGCCAGCAATGGACATACCAGACTGCGAAGCGGCAATAC
CAGAAAGATGCGAAGCTACCCAAGGGCTGGCATCAGTCCGACCTCGATCGCGGCTTCATCACCTCGGGCTTGTGG
GCCTACAGCAGGCATCCCAACTTTCTCGCCGAGCAAGCCATCTGGTTTATTCTGTACAACTGGGGCTGTCATGCC
ACCGATACCCTGTACAATTGGTCGTTTGTCGGCTGCGCGAGCTTGATCCTACTTTTCCAGGGTTCCACGTTTTTG
ACCGAGTCTATCACGGCCGGGAAGTATTCGGAGTACGCCGAGTATCAGAGGCAGGTGGGCATGTTTATGCCCATG
TCCTTTCGAGGATACCAGCCGACTGCAAACAAGCCCAGGGTCATCAGGTCAAGCGATTTGGCAAAGCGTCAGGAG
GAAACACGGAAGCAGAAA
Transcript >Ophio5|4937
ATGCATCTCCCCGCCCTCAGGTCCCTTCGTGACTGCGGCGACTACGCCCTGACGGTAAAGCCCTTCATTCCCCAG
CTGTACGCGCTACCGGAGCGGATAGCCGGCATCAGGAGCCTCGATGGCCTCAACCAGCTCTACGCCGAAACGAAC
CCGCTCATGTCGGCCTTTGCCGCTTCCATCGTGCTCGGGGGCGTTTTCCTCGTCGCCTCCGAGATCAACAGAAAC
TACTCTCAGGTCGACCGCTTCTGGAGCATCTTGCCAAACCTCTACGTCATACATCTGGCTGTCTGGGCCCGTCTT
GCCGACATCCCTCATAGCCGTGTCGACCTGGTCGCCGTCGTCACTACCATCTGGAGCTGTCGCTTGACCTTCAAT
TACTGGCGTCGAGGCGGCTATGAAATCGGCTCCGAGGACTACAGATGGGAAATCGTCAAGTCCCGAACCCACCCT
CTCGCCTTCTTCGTCCTCAACGTCACCTTCATCTCCTTCATCCAGAGCGTGCTATTGTTCAGCTTCTCCTGCCTC
CCCGCCTACGTCATCCTTCTGTCATCGCGCTTCCAGCCGCACGTCTCTGCAGCCGACGTCGGCTACTTTTCCGTC
CTGGTCCTGCTCGTGCTTAGTGAATGGATGAGCGATGGCCAGCAATGGACATACCAGACTGCGAAGCGGCAATAC
CAGAAAGATGCGAAGCTACCCAAGGGCTGGCATCAGTCCGACCTCGATCGCGGCTTCATCACCTCGGGCTTGTGG
GCCTACAGCAGGCATCCCAACTTTCTCGCCGAGCAAGCCATCTGGTTTATTCTGTACAACTGGGGCTGTCATGCC
ACCGATACCCTGTACAATTGGTCGTTTGTCGGCTGCGCGAGCTTGATCCTACTTTTCCAGGGTTCCACGTTTTTG
ACCGAGTCTATCACGGCCGGGAAGTATTCGGAGTACGCCGAGTATCAGAGGCAGGTGGGCATGTTTATGCCCATG
TCCTTTCGAGGATACCAGCCGACTGCAAACAAGCCCAGGGTCATCAGGTCAAGCGATTTGGCAAAGCGTCAGGAG
GAAACACGGAAGCAGAAATGA
Gene >Ophio5|4937
ATGCATCTCCCCGCCCTCAGGTCCCTTCGTGACTGCGGCGACTACGCCCTGACGGTAAAGCCCTTCATTCCCCAG
CTGTACGCGCTACCGGAGCGGATAGCCGGCATCAGGAGCCTCGATGGCCTCAACCAGCTCTACGCCGAAACGAAC
CCGCTCATGTCGGCCTTTGCCGCTTCCATCGTGCTCGGGGGCGTTTTCCTCGTCGCCTCCGAGATCAACAGAAAC
TACTCTCAGGTCGACCGCTTCTGGAGCATCTTGCCAAACCTCTACGTCATACATCTGGCTGTCTGGGCCCGTCTT
GCCGACATCCCTCATAGCCGTGTCGACCTGGTCGCCGTCGTCACTACCATCTGGAGCGTACGAAATACCATGCCT
CTCACTTGTCTGGTTTTTGGGCTCGCGCTGATGGCTTGCCTTCTGTCTAGTGTCGCTTGACCTTCAATTACTGGC
GTCGAGGCGGCTATGAAATCGGCTCCGAGGACTACAGATGGTGAGTGAGAAGGCATCGTCATGCTGAATCTGCCC
CAAAGTAACGTCCGATTACAGGGAAATCGTCAAGTCCCGAACCCACCCTCTCGCCTTCTTCGTCCTCAACGTCAC
CTTCATCTCCTTCATCCAGAGCGTGCTATTGTTCAGCTTCTCCTGCCTCCCCGCCTACGTCATCCTTCTGTCATC
GCGCTTCCAGCCGCACGTCTCTGCAGCCGACGTCGGCTACTTTTCCGTCCTGGTCCTGCTCGTGCTTAGTGAATG
GATGAGCGATGGCCAGCAATGGAGTATGCCTCGACACGCACCTTGAACCGTACAAGGCTGACCGACCCTACGATA
CAGCATACCAGACTGCGAAGCGGCAATACCAGAAAGATGCGAAGCTACCCAAGGGCTGGCATCAGTCCGACCTCG
ATCGCGGCTTCATCACCTCGGGCTTGTGGGCCTACAGCAGGCATCCCAACTTTCTCGCCGAGCAAGCCATCTGGT
TTATTCTGTACAACTGGGGCTGTCATGCCACCGATACCCTGTACAATTGGTCGTTTGTCGGCTGCGCGAGCTTGA
TCCTACTTTTCCAGGGTTCCACGTTTTTGACCGAGTCTATCACGGCCGGGAAGTATTCGGAGTACGCCGAGTATC
AGAGGCAGGTGGGCATGTTTATGCCCATGTCCTTTCGAGGATACCAGCCGACTGCAAACAAGCCCAGGGTCATCA
GGTCAAGCGATTTGGCAAAGCGTCAGGAGGAAACACGGAAGCAGAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail