Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4916
Gene name
Locationscaffold_396:12336..16382
Strand-
Gene length (bp)4046
Transcript length (bp)3936
Coding sequence length (bp)3933
Protein length (aa) 1311

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08626 TRAPPC9-Trs120 Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit 0.0E+00 6 1242

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14251|TR120_SCHPO Transport protein particle subunit trs120 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trs120 PE=3 SV=1 1 1240 5.0E-64
sp|Q04183|TR120_YEAST Trafficking protein particle complex II-specific subunit 120 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRS120 PE=1 SV=1 669 1228 2.0E-15
sp|Q04183|TR120_YEAST Trafficking protein particle complex II-specific subunit 120 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRS120 PE=1 SV=1 9 572 8.0E-11

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.7345 0.3532 0.0953 0.1248 0.0744 0.0066 0.1966 0.1548 0.5127 0.0091

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1934
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5747
Ophiocordyceps australis map64 (Brazil) OphauB2|8028
Ophiocordyceps camponoti-floridani Ophcf2|05342
Ophiocordyceps camponoti-rufipedis Ophun1|6870
Ophiocordyceps kimflemingae Ophio5|4916 (this protein)
Ophiocordyceps subramaniannii Hirsu2|207

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4916
MSLDPLLPIAPARVRVLLLPLGRLKAAKFADFVQRLQTEHVIYLRDISADGRPNRNMFSPLAFPNGAIFYHIVTH
MPPPSHLALSPFDLYREPLVVIALADGEELQHVASFSCRPAAAASVVESNVRALHQELEHLRDIYPKALVHRAVL
FDYVSNETPLPDGMVSVPPHQDCKRTTLKTVMCDVSSLLLAEMTTLAKSFEGMAAIESPGQVAASRQMAAGEGPL
GNGVSRRNSHFSVPHYDSRPVSATGVDGARQARMSMPPMASRPPISTSSSLPTRPTTPTKSSLPSIPMSPEDGQL
DASPEPKRDSSHDRVSVQGFGVGSPNDRWRLRGKSRTSVVVGSLYLQAGRWSDSLKELCDAASTARALNDHVWHG
KALELILINLLLLAWSGISFQVPLVCLPPQEQRSPNPPSLKGDKESDATDSMAQPLHIRQLQALLPELLDRIAGM
YSKVSSESLPPLPQSEAIIRLSRILLAMHVCGGKLDARALDMIARGTPHSQRLTTSPRLGLVPTRQHIVSFLFKA
FPSSATELLTTTDRASVLCGMASVLGSLGYYRKRAMVIRELVSVLIGGLVEARTRGAADAGVHPAAGLVSLTSGH
DGTSGAVALDLGEGDMEYGLEALLEHLCSSYGIVGFDNKDDDSDEAVVTRILDQSWARFFGLTGVKLNILRACIN
FSEALPDFHGVLKFSSDLLRTGGSGVAPGTRREDATPLIHRDEQVRLATNVSRTATLVQRLGMGHLTAEYWDDFL
VRSITLEPLSETRTPVPHARNDLPGASAERSSQGVNPFIYNPFLKEADEVAEQHLVAGETATFRVMLQNTYDIEV
EIESVRLCSEGVDFESSSERLTLGAYRTQLVRIRGRPREAGSIRLTGAIVKVCGCRERRFPIFPKAWTPPAQEKI
KVRGTAALEAVTPTEPAPEAKTVSFNVIAAQPLVVVQSTTLPQSAVMILEGERQRFSVTMRNVTAVPVDLMLFSF
KDATQAPLQEAISRRDATPAELYEYELILSKRQALRLVRNDQDRSIEAQGEATFEFEILGKPGLTTATIQLDYTF
LGAPRDEVKDRFFTRRVSLDLTATVNASVELTRVDALSVEGEVPAPVWERLGCRVPDRADEYCLLCMDLRNAWPS
LMVVRLEGEDGLAVEEHVLPGKSSRFVLPVKSIYMEGTHEAIPSLNPSRGRQFVISASKISPDMERANREAFWYR
ERLLEHVRATWRTMSVPRRDGVVELRNMRLTPRMIEAMRVDEGDGIRRRLFNADGAHYEPYTDDHLSSRPAAAGS
MPPTDQRRARSHSQVCLERNAAAAPPRARGPRLDEF
Coding >Ophio5|4916
ATGAGCCTCGATCCCTTGCTGCCCATCGCCCCAGCGAGAGTCCGGGTCCTGCTTCTTCCGCTCGGGAGGCTCAAG
GCGGCCAAGTTTGCCGACTTTGTTCAGAGGTTGCAGACGGAGCATGTCATTTACCTGCGCGACATTAGCGCTGAT
GGACGTCCGAATAGGAACATGTTCTCCCCCTTGGCGTTCCCCAACGGTGCCATCTTTTATCATATCGTCACTCAT
ATGCCGCCTCCGTCACACCTCGCCCTCTCGCCCTTTGACCTCTATCGCGAGCCCCTCGTCGTCATTGCCCTGGCT
GATGGTGAGGAGCTTCAGCATGTTGCCTCCTTCTCGTGTCGTCCCGCTGCTGCCGCGTCCGTCGTCGAGAGCAAC
GTCCGCGCCCTGCATCAGGAACTCGAGCATCTACGCGACATCTACCCCAAGGCTCTCGTCCACCGAGCCGTCCTC
TTCGACTATGTATCCAACGAGACACCTCTACCCGATGGCATGGTCTCCGTTCCGCCGCATCAGGATTGCAAACGC
ACGACGCTCAAGACGGTCATGTGTGACGTCTCGTCCCTGCTGCTGGCCGAGATGACGACGCTGGCAAAGTCGTTC
GAGGGCATGGCTGCCATTGAGTCTCCGGGACAAGTCGCTGCTTCGAGGCAGATGGCCGCTGGAGAGGGCCCCCTG
GGAAACGGTGTTTCGAGGAGAAATTCGCACTTTTCCGTACCGCACTACGACTCGCGTCCGGTTTCGGCTACCGGC
GTAGACGGCGCCCGTCAAGCTCGCATGTCGATGCCCCCGATGGCGTCTCGACCCCCCATCAGTACCAGCAGCTCT
CTGCCGACACGGCCCACGACCCCGACCAAGAGCAGCCTGCCGAGCATACCGATGAGCCCCGAAGACGGACAGCTG
GACGCGAGCCCCGAGCCGAAGCGTGACAGCTCCCACGACCGTGTCTCCGTACAGGGCTTCGGCGTCGGCAGCCCA
AACGACCGCTGGCGCCTACGGGGGAAAAGCCGCACCTCGGTCGTCGTTGGCTCTCTATATCTGCAGGCCGGCAGG
TGGAGCGATTCGCTCAAGGAACTGTGCGACGCCGCCTCGACCGCGCGCGCGCTCAACGATCATGTCTGGCACGGC
AAGGCGCTGGAGCTGATCTTGATAAACTTGCTTCTTCTGGCCTGGTCCGGCATAAGCTTTCAGGTGCCCCTGGTC
TGTCTGCCCCCTCAGGAGCAGCGATCACCCAACCCGCCGTCCCTCAAGGGGGACAAGGAGTCGGACGCGACGGAT
TCCATGGCGCAGCCGTTACATATACGACAGCTGCAGGCTCTTCTGCCAGAGCTTCTCGACCGCATCGCTGGCATG
TACTCCAAGGTTTCGTCGGAGAGTCTGCCGCCGCTGCCGCAGTCGGAAGCCATCATCAGGCTCTCCCGGATCCTG
TTGGCGATGCACGTCTGCGGGGGGAAGCTGGATGCTCGGGCGCTCGACATGATTGCTCGTGGTACGCCGCATAGC
CAGCGTCTGACGACGTCTCCGAGGCTGGGCCTTGTCCCCACGCGGCAACACATTGTCAGCTTTCTTTTCAAAGCC
TTTCCCTCGTCGGCCACGGAGCTCCTTACCACGACGGACCGAGCGTCGGTGCTGTGCGGCATGGCCTCGGTCCTC
GGCTCTCTGGGATACTACCGGAAGAGGGCCATGGTGATCCGCGAGCTGGTCTCGGTCCTGATCGGGGGACTCGTC
GAAGCCCGGACGCGGGGGGCCGCCGACGCCGGTGTCCATCCGGCAGCCGGCCTCGTGTCGCTGACATCGGGCCAC
GACGGGACCAGCGGCGCCGTGGCCCTGGATCTGGGAGAGGGAGACATGGAGTATGGGCTGGAGGCGCTGCTGGAG
CACCTGTGCAGCTCGTACGGCATCGTCGGCTTCGACAACAAGGATGATGATTCGGACGAGGCGGTCGTTACCCGC
ATTCTCGACCAATCTTGGGCTCGCTTCTTCGGCCTTACTGGCGTCAAGCTTAACATCCTACGCGCCTGCATCAAC
TTCTCGGAGGCGCTGCCCGACTTTCACGGCGTTCTCAAGTTCTCGAGCGACCTCCTTCGGACGGGCGGCTCCGGC
GTCGCGCCCGGCACGAGGCGTGAGGACGCTACCCCCCTGATCCACAGGGACGAGCAGGTCCGGCTGGCGACCAAC
GTGTCCCGGACGGCGACGCTGGTTCAGAGGCTCGGCATGGGCCACCTGACGGCCGAGTACTGGGACGATTTTCTC
GTCAGGAGCATCACGTTGGAGCCGCTGTCGGAGACGCGGACGCCGGTGCCTCACGCCCGCAACGATCTGCCGGGG
GCCTCGGCCGAGCGTTCTTCGCAAGGCGTGAACCCGTTTATATACAATCCGTTTCTGAAGGAGGCTGACGAGGTG
GCGGAGCAGCATCTGGTGGCGGGCGAGACGGCAACCTTTCGGGTGATGCTGCAGAACACGTACGACATCGAGGTG
GAGATTGAGAGCGTGCGCCTGTGCAGCGAAGGTGTCGACTTCGAATCGTCGTCGGAGAGGCTGACGCTCGGCGCG
TATCGCACGCAGCTGGTGCGCATCAGGGGCCGGCCACGGGAGGCCGGCTCCATCCGGCTGACGGGCGCCATTGTC
AAGGTCTGCGGCTGCAGGGAGAGGCGATTTCCCATCTTCCCCAAGGCCTGGACGCCGCCGGCGCAGGAGAAGATC
AAGGTCAGGGGCACGGCAGCGCTGGAAGCCGTTACGCCAACGGAGCCGGCTCCCGAGGCCAAGACGGTGAGCTTC
AACGTGATAGCAGCCCAGCCGCTGGTGGTGGTGCAGTCGACGACGCTGCCACAGTCGGCCGTCATGATCCTCGAG
GGCGAGAGGCAGAGGTTTTCGGTCACGATGCGGAACGTCACGGCCGTGCCGGTCGACCTGATGCTCTTCTCCTTC
AAGGACGCGACGCAGGCGCCGCTACAGGAAGCCATCAGCAGGCGAGACGCGACCCCGGCCGAGCTCTACGAGTAC
GAGCTCATCCTCAGCAAGAGACAGGCGCTGCGGCTCGTACGCAACGACCAGGACCGCAGCATCGAGGCCCAAGGC
GAGGCCACATTCGAGTTTGAGATTCTCGGCAAGCCGGGCCTGACCACCGCCACCATCCAGCTCGACTACACCTTT
CTGGGGGCGCCGCGAGACGAGGTGAAGGACCGTTTCTTTACCCGCCGCGTCTCGCTCGACCTCACGGCGACGGTC
AATGCCAGTGTCGAGCTGACGCGCGTCGACGCGTTATCGGTCGAGGGCGAGGTGCCGGCACCCGTCTGGGAGAGG
CTGGGCTGCCGCGTGCCGGACCGGGCCGACGAATACTGCCTATTATGTATGGACCTGCGCAACGCCTGGCCGAGC
CTCATGGTCGTTCGTCTCGAAGGCGAGGATGGGCTGGCAGTGGAGGAGCACGTGCTTCCGGGCAAATCGAGCCGC
TTCGTGCTGCCGGTCAAGAGCATCTACATGGAGGGTACGCACGAAGCGATCCCGAGCCTGAACCCGTCGCGGGGC
CGGCAGTTTGTCATCAGCGCGAGCAAGATCTCGCCCGACATGGAAAGGGCCAACCGCGAGGCGTTTTGGTACCGC
GAGAGGCTGCTGGAGCACGTCCGGGCTACTTGGAGGACGATGTCGGTGCCGAGACGGGACGGAGTCGTCGAGCTC
CGGAACATGCGTCTGACGCCCCGGATGATTGAGGCGATGCGCGTCGACGAGGGCGACGGCATTCGTCGACGACTT
TTTAACGCTGACGGTGCGCATTACGAACCGTACACCGACGACCATCTATCCTCTCGTCCGGCTGCTGCCGGCTCT
ATGCCACCGACCGACCAACGTCGCGCTCGATCACACTCGCAAGTTTGCCTGGAACGGAACGCTGCAGCAGCTCCT
CCCCGCGCTCGAGGGCCACGGCTCGACGAGTTT
Transcript >Ophio5|4916
ATGAGCCTCGATCCCTTGCTGCCCATCGCCCCAGCGAGAGTCCGGGTCCTGCTTCTTCCGCTCGGGAGGCTCAAG
GCGGCCAAGTTTGCCGACTTTGTTCAGAGGTTGCAGACGGAGCATGTCATTTACCTGCGCGACATTAGCGCTGAT
GGACGTCCGAATAGGAACATGTTCTCCCCCTTGGCGTTCCCCAACGGTGCCATCTTTTATCATATCGTCACTCAT
ATGCCGCCTCCGTCACACCTCGCCCTCTCGCCCTTTGACCTCTATCGCGAGCCCCTCGTCGTCATTGCCCTGGCT
GATGGTGAGGAGCTTCAGCATGTTGCCTCCTTCTCGTGTCGTCCCGCTGCTGCCGCGTCCGTCGTCGAGAGCAAC
GTCCGCGCCCTGCATCAGGAACTCGAGCATCTACGCGACATCTACCCCAAGGCTCTCGTCCACCGAGCCGTCCTC
TTCGACTATGTATCCAACGAGACACCTCTACCCGATGGCATGGTCTCCGTTCCGCCGCATCAGGATTGCAAACGC
ACGACGCTCAAGACGGTCATGTGTGACGTCTCGTCCCTGCTGCTGGCCGAGATGACGACGCTGGCAAAGTCGTTC
GAGGGCATGGCTGCCATTGAGTCTCCGGGACAAGTCGCTGCTTCGAGGCAGATGGCCGCTGGAGAGGGCCCCCTG
GGAAACGGTGTTTCGAGGAGAAATTCGCACTTTTCCGTACCGCACTACGACTCGCGTCCGGTTTCGGCTACCGGC
GTAGACGGCGCCCGTCAAGCTCGCATGTCGATGCCCCCGATGGCGTCTCGACCCCCCATCAGTACCAGCAGCTCT
CTGCCGACACGGCCCACGACCCCGACCAAGAGCAGCCTGCCGAGCATACCGATGAGCCCCGAAGACGGACAGCTG
GACGCGAGCCCCGAGCCGAAGCGTGACAGCTCCCACGACCGTGTCTCCGTACAGGGCTTCGGCGTCGGCAGCCCA
AACGACCGCTGGCGCCTACGGGGGAAAAGCCGCACCTCGGTCGTCGTTGGCTCTCTATATCTGCAGGCCGGCAGG
TGGAGCGATTCGCTCAAGGAACTGTGCGACGCCGCCTCGACCGCGCGCGCGCTCAACGATCATGTCTGGCACGGC
AAGGCGCTGGAGCTGATCTTGATAAACTTGCTTCTTCTGGCCTGGTCCGGCATAAGCTTTCAGGTGCCCCTGGTC
TGTCTGCCCCCTCAGGAGCAGCGATCACCCAACCCGCCGTCCCTCAAGGGGGACAAGGAGTCGGACGCGACGGAT
TCCATGGCGCAGCCGTTACATATACGACAGCTGCAGGCTCTTCTGCCAGAGCTTCTCGACCGCATCGCTGGCATG
TACTCCAAGGTTTCGTCGGAGAGTCTGCCGCCGCTGCCGCAGTCGGAAGCCATCATCAGGCTCTCCCGGATCCTG
TTGGCGATGCACGTCTGCGGGGGGAAGCTGGATGCTCGGGCGCTCGACATGATTGCTCGTGGTACGCCGCATAGC
CAGCGTCTGACGACGTCTCCGAGGCTGGGCCTTGTCCCCACGCGGCAACACATTGTCAGCTTTCTTTTCAAAGCC
TTTCCCTCGTCGGCCACGGAGCTCCTTACCACGACGGACCGAGCGTCGGTGCTGTGCGGCATGGCCTCGGTCCTC
GGCTCTCTGGGATACTACCGGAAGAGGGCCATGGTGATCCGCGAGCTGGTCTCGGTCCTGATCGGGGGACTCGTC
GAAGCCCGGACGCGGGGGGCCGCCGACGCCGGTGTCCATCCGGCAGCCGGCCTCGTGTCGCTGACATCGGGCCAC
GACGGGACCAGCGGCGCCGTGGCCCTGGATCTGGGAGAGGGAGACATGGAGTATGGGCTGGAGGCGCTGCTGGAG
CACCTGTGCAGCTCGTACGGCATCGTCGGCTTCGACAACAAGGATGATGATTCGGACGAGGCGGTCGTTACCCGC
ATTCTCGACCAATCTTGGGCTCGCTTCTTCGGCCTTACTGGCGTCAAGCTTAACATCCTACGCGCCTGCATCAAC
TTCTCGGAGGCGCTGCCCGACTTTCACGGCGTTCTCAAGTTCTCGAGCGACCTCCTTCGGACGGGCGGCTCCGGC
GTCGCGCCCGGCACGAGGCGTGAGGACGCTACCCCCCTGATCCACAGGGACGAGCAGGTCCGGCTGGCGACCAAC
GTGTCCCGGACGGCGACGCTGGTTCAGAGGCTCGGCATGGGCCACCTGACGGCCGAGTACTGGGACGATTTTCTC
GTCAGGAGCATCACGTTGGAGCCGCTGTCGGAGACGCGGACGCCGGTGCCTCACGCCCGCAACGATCTGCCGGGG
GCCTCGGCCGAGCGTTCTTCGCAAGGCGTGAACCCGTTTATATACAATCCGTTTCTGAAGGAGGCTGACGAGGTG
GCGGAGCAGCATCTGGTGGCGGGCGAGACGGCAACCTTTCGGGTGATGCTGCAGAACACGTACGACATCGAGGTG
GAGATTGAGAGCGTGCGCCTGTGCAGCGAAGGTGTCGACTTCGAATCGTCGTCGGAGAGGCTGACGCTCGGCGCG
TATCGCACGCAGCTGGTGCGCATCAGGGGCCGGCCACGGGAGGCCGGCTCCATCCGGCTGACGGGCGCCATTGTC
AAGGTCTGCGGCTGCAGGGAGAGGCGATTTCCCATCTTCCCCAAGGCCTGGACGCCGCCGGCGCAGGAGAAGATC
AAGGTCAGGGGCACGGCAGCGCTGGAAGCCGTTACGCCAACGGAGCCGGCTCCCGAGGCCAAGACGGTGAGCTTC
AACGTGATAGCAGCCCAGCCGCTGGTGGTGGTGCAGTCGACGACGCTGCCACAGTCGGCCGTCATGATCCTCGAG
GGCGAGAGGCAGAGGTTTTCGGTCACGATGCGGAACGTCACGGCCGTGCCGGTCGACCTGATGCTCTTCTCCTTC
AAGGACGCGACGCAGGCGCCGCTACAGGAAGCCATCAGCAGGCGAGACGCGACCCCGGCCGAGCTCTACGAGTAC
GAGCTCATCCTCAGCAAGAGACAGGCGCTGCGGCTCGTACGCAACGACCAGGACCGCAGCATCGAGGCCCAAGGC
GAGGCCACATTCGAGTTTGAGATTCTCGGCAAGCCGGGCCTGACCACCGCCACCATCCAGCTCGACTACACCTTT
CTGGGGGCGCCGCGAGACGAGGTGAAGGACCGTTTCTTTACCCGCCGCGTCTCGCTCGACCTCACGGCGACGGTC
AATGCCAGTGTCGAGCTGACGCGCGTCGACGCGTTATCGGTCGAGGGCGAGGTGCCGGCACCCGTCTGGGAGAGG
CTGGGCTGCCGCGTGCCGGACCGGGCCGACGAATACTGCCTATTATGTATGGACCTGCGCAACGCCTGGCCGAGC
CTCATGGTCGTTCGTCTCGAAGGCGAGGATGGGCTGGCAGTGGAGGAGCACGTGCTTCCGGGCAAATCGAGCCGC
TTCGTGCTGCCGGTCAAGAGCATCTACATGGAGGGTACGCACGAAGCGATCCCGAGCCTGAACCCGTCGCGGGGC
CGGCAGTTTGTCATCAGCGCGAGCAAGATCTCGCCCGACATGGAAAGGGCCAACCGCGAGGCGTTTTGGTACCGC
GAGAGGCTGCTGGAGCACGTCCGGGCTACTTGGAGGACGATGTCGGTGCCGAGACGGGACGGAGTCGTCGAGCTC
CGGAACATGCGTCTGACGCCCCGGATGATTGAGGCGATGCGCGTCGACGAGGGCGACGGCATTCGTCGACGACTT
TTTAACGCTGACGGTGCGCATTACGAACCGTACACCGACGACCATCTATCCTCTCGTCCGGCTGCTGCCGGCTCT
ATGCCACCGACCGACCAACGTCGCGCTCGATCACACTCGCAAGTTTGCCTGGAACGGAACGCTGCAGCAGCTCCT
CCCCGCGCTCGAGGGCCACGGCTCGACGAGTTTTAG
Gene >Ophio5|4916
ATGAGCCTCGATCCCTTGCTGCCCATCGCCCCAGCGAGAGTCCGGGTCCTGCTTCTTCCGCTCGGGAGGCTCAAG
GCGGCCAAGTTTGCCGACTTTGTTCAGAGGTTGCAGACGGAGCATGTCATTTACCTGCGCGACATTAGCGCTGAT
GGACGTCCGAATAGGAGTCAGTGCTTTTTCTTGACCCGTTGGAGAAAGAGTTGTCATGGCTGATTCTGTTTAGAC
ATGTTCTCCCCCTTGGCGTTCCCCAACGGTGCCATCTTTTATCATATCGTCACTCATATGCCGCCTCCGTCACAC
CTCGCCCTCTCGCCCTTTGACCTCTATCGCGAGCCCCTCGTCGTCATTGCCCTGGCTGATGGTGAGGAGCTTCAG
CATGTTGCCTCCTTCTCGTGTCGTCCCGCTGCTGCCGCGTCCGTCGTCGAGAGCAACGTCCGCGCCCTGCATCAG
GAACTCGAGCATCTACGCGACATCTACCCCAAGGCTCTCGTCCACCGAGCCGTCCTCTTCGACTATGTATCCAAC
GAGACACCTCTACCCGATGGCATGGTCTCCGTTCCGCCGCATCAGGATTGCAAACGCACGACGCTCAAGACGGTC
ATGTGTGACGTCTCGTCCCTGCTGCTGGCCGAGATGACGACGCTGGCAAAGTCGTTCGAGGGCATGGCTGCCATT
GAGTCTCCGGGACAAGTCGCTGCTTCGAGGCAGATGGCCGCTGGAGAGGGCCCCCTGGGAAACGGTGTTTCGAGG
AGAAATTCGCACTTTTCCGTACCGCACTACGACTCGCGTCCGGTTTCGGCTACCGGCGTAGACGGCGCCCGTCAA
GCTCGCATGTCGATGCCCCCGATGGCGTCTCGACCCCCCATCAGTACCAGCAGCTCTCTGCCGACACGGCCCACG
ACCCCGACCAAGAGCAGCCTGCCGAGCATACCGATGAGCCCCGAAGACGGACAGCTGGACGCGAGCCCCGAGCCG
AAGCGTGACAGCTCCCACGACCGTGTCTCCGTACAGGGCTTCGGCGTCGGCAGCCCAAACGACCGCTGGCGCCTA
CGGGGGAAAAGCCGCACCTCGGTCGTCGTTGGCTCTCTATATCTGCAGGCCGGCAGGTGGAGCGATTCGCTCAAG
GAACTGTGCGACGCCGCCTCGACCGCGCGCGCGCTCAACGATCATGTCTGGCACGGCAAGGCGCTGGAGCTGATC
TTGATAAACTTGCTTCTTCTGGCCTGGTCCGGCATAAGCTTTCAGGTGCCCCTGGTCTGTCTGCCCCCTCAGGAG
CAGCGATCACCCAACCCGCCGTCCCTCAAGGGGGACAAGGAGTCGGACGCGACGGATTCCATGGCGCAGCCGTTA
CATATACGACAGCTGCAGGCTCTTCTGCCAGAGCTTCTCGACCGCATCGCTGGCATGTACTCCAAGGTTTCGTCG
GAGAGTCTGCCGCCGCTGCCGCAGTCGGAAGCCATCATCAGGCTCTCCCGGATCCTGTTGGCGATGCACGTCTGC
GGGGGGAAGCTGGATGCTCGGGCGCTCGACATGATTGCTCGTGGTACGCCGCATAGCCAGCGTCTGACGACGTCT
CCGAGGCTGGGCCTTGTCCCCACGCGGCAACACATTGTCAGCTTTCTTTTCAAAGCCTTTCCCTCGTCGGCCACG
GAGCTCCTTACCACGACGGACCGAGCGTCGGTGCTGTGCGGCATGGCCTCGGTCCTCGGCTCTCTGGGATACTAC
CGGAAGAGGGCCATGGTGATCCGCGAGCTGGTCTCGGTCCTGATCGGGGGACTCGTCGAAGCCCGGACGCGGGGG
GCCGCCGACGCCGGTGTCCATCCGGCAGCCGGCCTCGTGTCGCTGACATCGGGCCACGACGGGACCAGCGGCGCC
GTGGCCCTGGATCTGGGAGAGGGAGACATGGAGTATGGGCTGGAGGCGCTGCTGGAGCACCTGTGCAGCTCGTAC
GGCATCGTCGGCTTCGACAACAAGGATGATGATTCGGACGAGGCGGTCGTTACCCGCATTCTCGACCAATCTTGG
GCTCGCTTCTTCGGCCTTACTGGCGTCAAGCTTAACATCCTACGCGCCTGCATCAACTTCTCGGAGGCGCTGCCC
GACTTTCACGGCGTTCTCAAGTTCTCGAGCGACCTCCTTCGGACGGGCGGCTCCGGCGTCGCGCCCGGCACGAGG
CGTGAGGACGCTACCCCCCTGATCCACAGGGACGAGCAGGTCCGGCTGGCGACCAACGTGTCCCGGACGGCGACG
CTGGTTCAGAGGCTCGGCATGGGCCACCTGACGGCCGAGTACTGGGACGATTTTCTCGTCAGGAGCATCACGTTG
GAGCCGCTGTCGGAGACGCGGACGCCGGTGCCTCACGCCCGCAACGATCTGCCGGGGGCCTCGGCCGAGCGTTCT
TCGCAAGGCGTGAACCCGTTTATATACAATCCGTTTCTGAAGGAGGCTGACGAGGTGGCGGAGCAGCATCTGGTG
GCGGGCGAGACGGCAACCTTTCGGGTGATGCTGCAGAACACGTACGACATCGAGGTGGAGATTGAGAGCGTGCGC
CTGTGCAGCGAAGGTGTCGACTTCGAATCGTCGTCGGAGAGGCTGACGCTCGGCGCGTATCGCACGCAGCTGGTG
CGCATCAGGGGCCGGCCACGGGAGGCCGGCTCCATCCGGCTGACGGGCGCCATTGTCAAGGTCTGCGGCTGCAGG
GAGAGGCGATTTCCCATCTTCCCCAAGGCCTGGACGCCGCCGGCGCAGGAGAAGATCAAGGTCAGGGGCACGGCA
GCGCTGGAAGCCGTTACGCCAACGGAGCCGGCTCCCGAGGCCAAGACGGTGAGCTTCAACGTGATAGCAGCCCAG
CCGCTGGTGGTGGTGCAGTCGACGACGCTGCCACAGTCGGCCGTCATGATCCTCGAGGGCGAGAGGCAGAGGTTT
TCGGTCACGATGCGGAACGTCACGGCCGTGCCGGTCGACCTGATGCTCTTCTCCTTCAAGGACGCGACGCAGGCG
CCGCTACAGGAAGCCATCAGCAGGCGAGACGCGACCCCGGCCGAGCTCTACGAGTACGAGCTCATCCTCAGCAAG
AGACAGGCGCTGCGGCTCGTACGCAACGACCAGGACCGCAGCATCGAGGCCCAAGGCGAGGCCACATTCGAGTTT
GAGATTCTCGGCAAGCCGGGCCTGACCACCGCCACCATCCAGCTCGACTACACCTTTCTGGGGGCGCCGCGAGAC
GAGGTGAAGGACCGTTTCTTTACCCGCCGCGTCTCGCTCGACCTCACGGCGACGGTCAATGCCAGTGTCGAGCTG
ACGCGCGTCGACGCGTTATCGGTCGAGGGCGAGGTGCCGGCACCCGTCTGGGAGAGGCTGGGCTGCCGCGTGCCG
GACCGGGCCGACGAATACTGCCTATTATGTATGGACCTGCGCAACGCCTGGCCGAGCCTCATGGTCGTTCGTCTC
GAAGGCGAGGATGGGCTGGCAGTGGAGGAGCACGTGCTTCCGGGCAAATCGAGCCGCTTCGTGCTGCCGGTCAAG
AGCATCTACATGGAGGGTACGCACGAAGCGATCCCGAGCCTGAACCCGTCGCGGGGCCGGCAGTTTGTCATCAGC
GCGAGCAAGATCTCGCCCGACATGGAAAGGGCCAACCGCGAGGCGTTTTGGTACCGCGAGAGGCTGCTGGAGCAC
GTCCGGGCTACTTGGAGGACGATGTCGGTGCCGAGACGGGACGGAGTCGTCGAGCTCCGGAACATGCGTCTGACG
CCCCGGATGATTGAGGCGATGCGCGTCGACGAGGTGGGCATCGATATCACCGTCGAAGACAACGCGGCTTCGACG
AGCGGCGGCAGGGCGACGGCATTCGTCGACGACTTTTTAACGCTGACGGTGCGCATTACGAACCGTACACCGACG
ACCATCTATCCTCTCGTCCGGCTGCTGCCGGCTCTATGCCACCGACCGACCAACGTCGCGCTCGATCACACTCGC
AAGTTTGCCTGGAACGGAACGCTGCAGCAGCTCCTCCCCGCGCTCGAGGGCCACGGCTCGACGAGTTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail