Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4914
Gene name
Locationscaffold_396:7677..8128
Strand+
Gene length (bp)451
Transcript length (bp)390
Coding sequence length (bp)387
Protein length (aa) 129

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04133 Vps55 Vacuolar protein sorting 55 2.5E-44 9 126

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUH1|VPS55_SCHPO Vacuolar protein sorting-associated protein 55 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps55 PE=3 SV=2 4 129 8.0E-29
sp|P47111|VPS55_YEAST Vacuolar protein sorting-associated protein 55 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS55 PE=1 SV=1 6 126 4.0E-27
sp|Q54VP1|VPS55_DICDI Vacuolar protein sorting-associated protein 55 homolog OS=Dictyostelium discoideum GN=vps55 PE=3 SV=1 7 128 5.0E-23
sp|O89013|OBRG_MOUSE Leptin receptor gene-related protein OS=Mus musculus GN=Leprot PE=1 SV=1 4 129 4.0E-16
sp|Q9JLS8|OBRG_RAT Leptin receptor gene-related protein OS=Rattus norvegicus GN=Leprot PE=1 SV=1 4 129 4.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUH1|VPS55_SCHPO Vacuolar protein sorting-associated protein 55 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps55 PE=3 SV=2 4 129 8.0E-29
sp|P47111|VPS55_YEAST Vacuolar protein sorting-associated protein 55 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS55 PE=1 SV=1 6 126 4.0E-27
sp|Q54VP1|VPS55_DICDI Vacuolar protein sorting-associated protein 55 homolog OS=Dictyostelium discoideum GN=vps55 PE=3 SV=1 7 128 5.0E-23
sp|O89013|OBRG_MOUSE Leptin receptor gene-related protein OS=Mus musculus GN=Leprot PE=1 SV=1 4 129 4.0E-16
sp|Q9JLS8|OBRG_RAT Leptin receptor gene-related protein OS=Rattus norvegicus GN=Leprot PE=1 SV=1 4 129 4.0E-14
sp|Q32PD8|LERL1_BOVIN Leptin receptor overlapping transcript-like 1 OS=Bos taurus GN=LEPROTL1 PE=2 SV=1 4 129 4.0E-14
sp|Q561T9|OBRG_DANRE Leptin receptor gene-related protein OS=Danio rerio GN=leprot PE=2 SV=1 4 129 5.0E-14
sp|Q3SYT0|OBRG_BOVIN Leptin receptor gene-related protein OS=Bos taurus GN=LEPROT PE=2 SV=1 4 129 8.0E-14
sp|Q9CQ74|LERL1_MOUSE Leptin receptor overlapping transcript-like 1 OS=Mus musculus GN=Leprotl1 PE=2 SV=1 4 129 8.0E-14
sp|Q6PDU4|LERL1_RAT Leptin receptor overlapping transcript-like 1 OS=Rattus norvegicus GN=Leprotl1 PE=1 SV=1 4 129 1.0E-13
sp|O15243|OBRG_HUMAN Leptin receptor gene-related protein OS=Homo sapiens GN=LEPROT PE=2 SV=1 4 129 1.0E-13
sp|O95214|LERL1_HUMAN Leptin receptor overlapping transcript-like 1 OS=Homo sapiens GN=LEPROTL1 PE=2 SV=2 4 129 1.0E-13
sp|Q5RDE9|LERL1_PONAB Leptin receptor overlapping transcript-like 1 OS=Pongo abelii GN=LEPROTL1 PE=2 SV=1 4 129 1.0E-13
sp|B9TRX0|OBRG_PIG Leptin receptor gene-related protein OS=Sus scrofa GN=LEPROT PE=2 SV=1 4 129 2.0E-13
sp|Q18319|VPS55_CAEEL Vacuolar protein sorting-associated protein 55 homolog OS=Caenorhabditis elegans GN=C30B5.2 PE=3 SV=3 4 128 3.0E-11
sp|Q5PSV5|OBRG_MELGA Leptin receptor gene-related protein OS=Meleagris gallopavo GN=LEPROT PE=2 SV=1 4 129 4.0E-10
sp|Q5ZJD9|OBRG_CHICK Leptin receptor gene-related protein OS=Gallus gallus GN=LEPROT PE=2 SV=1 4 129 4.0E-10
sp|Q9AST6|VSP55_ARATH Vacuolar protein sorting-associated protein 55 homolog OS=Arabidopsis thaliana GN=At1g32410 PE=2 SV=1 12 106 2.0E-07
sp|B3Y064|OBRG_TAKRU Leptin receptor gene-related protein OS=Takifugu rubripes GN=leprot PE=2 SV=1 4 116 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 33 52 19
3 72 94 22
4 101 123 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4914
MPAAGLKTIIALSFVLAVGFLLVILSCALFKVYYPLLVVATFVIAPLPNWICARCANPDDFVESSGAAVLDLGRF
FTGFFVVMGIALPVVLAHSDLIRVEAMIMSIVGGLLIYGTIISFGMFFHEEQEF
Coding >Ophio5|4914
ATGCCCGCGGCCGGTCTCAAGACCATCATAGCCCTATCCTTCGTCCTTGCCGTCGGCTTCCTGCTCGTCATTCTA
TCATGCGCCCTTTTCAAAGTTTATTACCCGCTGCTCGTCGTCGCTACTTTCGTCATCGCTCCGTTGCCGAATTGG
ATCTGTGCCCGTTGCGCCAACCCGGATGATTTTGTGGAGAGCTCTGGGGCTGCTGTTCTCGACCTTGGTCGCTTC
TTTACCGGCTTCTTCGTCGTCATGGGCATTGCCCTCCCCGTCGTCCTCGCACACTCCGACCTCATCAGGGTCGAG
GCCATGATCATGTCCATAGTCGGCGGCCTCCTGATCTACGGGACCATCATAAGCTTCGGCATGTTCTTCCACGAG
GAGCAGGAGTTT
Transcript >Ophio5|4914
ATGCCCGCGGCCGGTCTCAAGACCATCATAGCCCTATCCTTCGTCCTTGCCGTCGGCTTCCTGCTCGTCATTCTA
TCATGCGCCCTTTTCAAAGTTTATTACCCGCTGCTCGTCGTCGCTACTTTCGTCATCGCTCCGTTGCCGAATTGG
ATCTGTGCCCGTTGCGCCAACCCGGATGATTTTGTGGAGAGCTCTGGGGCTGCTGTTCTCGACCTTGGTCGCTTC
TTTACCGGCTTCTTCGTCGTCATGGGCATTGCCCTCCCCGTCGTCCTCGCACACTCCGACCTCATCAGGGTCGAG
GCCATGATCATGTCCATAGTCGGCGGCCTCCTGATCTACGGGACCATCATAAGCTTCGGCATGTTCTTCCACGAG
GAGCAGGAGTTTTGA
Gene >Ophio5|4914
ATGCCCGCGGCCGGTCTCAAGACCATCATAGCCCTATCCTTCGTCCTTGCCGTCGGCTTCCTGCTCGTCATTCTA
TCATGCGCCCTTTTCAAAGTTTATTACCCGCTGCTCGTCGTCGCTACTTTCGTCATCGCTCCGTTGCCGAATTGG
ATCTGTGCCCGTTGCGCCAACCCGGATGATTTTGTGGAGAGCTCTGGGGCTGCTGTTCTCGACCTTGGTCGCTTC
TTTACCGGCTTCTTCGTCGTCATGGGCATTGGTTCGCTTTCCACCATGCCCTTTTTATGTTGTTGCGCTCCGCTG
ACTCTCGCCTTCGCCAGCCCTCCCCGTCGTCCTCGCACACTCCGACCTCATCAGGGTCGAGGCCATGATCATGTC
CATAGTCGGCGGCCTCCTGATCTACGGGACCATCATAAGCTTCGGCATGTTCTTCCACGAGGAGCAGGAGTTTTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail