Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4912
Gene name
Locationscaffold_396:5266..5857
Strand-
Gene length (bp)591
Transcript length (bp)591
Coding sequence length (bp)588
Protein length (aa) 196

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14475 Mso1_Sec1_bdg Sec1-binding region of Mso1 6.3E-18 18 57

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6114 0.2038 0.0595 0.0643 0.2698 0.0047 0.0894 0.1521 0.1466 0.0592

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6343
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4916
Ophiocordyceps australis map64 (Brazil) OphauB2|1664
Ophiocordyceps camponoti-floridani Ophcf2|05339
Ophiocordyceps camponoti-rufipedis Ophun1|212
Ophiocordyceps kimflemingae Ophio5|4912 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4912
MASWYSSILTKTTSHISSLRATLLSSDADGEDDDDTHVCRVLRNYYTDKGRPLPSWLPPDPKAPAAAPAPAAPQQ
PAVGSRYGARAQQQQQQQSGGGLSSLWDSSGGAQQRSNDLAPPRPDMPNQRAGSYQASASAQDRLRQRLRASAGP
GGARTASPQGPNGPFAPPAAESVASPRRVQGLPLDPRRPGGPRGYR
Coding >Ophio5|4912
ATGGCTTCGTGGTACTCGTCCATACTCACAAAGACGACGTCGCACATTTCCTCCCTTCGCGCCACGCTTCTCTCG
TCCGACGCAGACGGCGAAGACGACGACGACACACACGTCTGTCGCGTCCTGCGCAACTATTACACAGACAAGGGC
CGACCCCTCCCTTCCTGGCTCCCCCCCGATCCCAAAGCTCCGGCAGCGGCGCCTGCACCAGCGGCCCCACAACAG
CCAGCCGTCGGATCGCGATACGGGGCACGAGCACAACAGCAGCAACAACAGCAGAGTGGTGGAGGACTCAGCAGT
CTATGGGATAGCAGTGGCGGCGCACAACAACGAAGCAACGACTTGGCACCGCCTCGACCGGACATGCCCAACCAG
CGAGCAGGCTCCTACCAGGCGTCCGCTTCGGCCCAGGATCGGCTCCGGCAGAGGTTGAGGGCTTCGGCCGGACCA
GGGGGGGCTCGTACGGCGAGTCCGCAGGGGCCGAATGGGCCGTTTGCACCCCCGGCGGCTGAGTCGGTGGCTTCG
CCTCGGCGCGTGCAGGGTTTACCTTTGGATCCGAGACGGCCGGGGGGGCCGAGGGGGTATCGG
Transcript >Ophio5|4912
ATGGCTTCGTGGTACTCGTCCATACTCACAAAGACGACGTCGCACATTTCCTCCCTTCGCGCCACGCTTCTCTCG
TCCGACGCAGACGGCGAAGACGACGACGACACACACGTCTGTCGCGTCCTGCGCAACTATTACACAGACAAGGGC
CGACCCCTCCCTTCCTGGCTCCCCCCCGATCCCAAAGCTCCGGCAGCGGCGCCTGCACCAGCGGCCCCACAACAG
CCAGCCGTCGGATCGCGATACGGGGCACGAGCACAACAGCAGCAACAACAGCAGAGTGGTGGAGGACTCAGCAGT
CTATGGGATAGCAGTGGCGGCGCACAACAACGAAGCAACGACTTGGCACCGCCTCGACCGGACATGCCCAACCAG
CGAGCAGGCTCCTACCAGGCGTCCGCTTCGGCCCAGGATCGGCTCCGGCAGAGGTTGAGGGCTTCGGCCGGACCA
GGGGGGGCTCGTACGGCGAGTCCGCAGGGGCCGAATGGGCCGTTTGCACCCCCGGCGGCTGAGTCGGTGGCTTCG
CCTCGGCGCGTGCAGGGTTTACCTTTGGATCCGAGACGGCCGGGGGGGCCGAGGGGGTATCGGTGA
Gene >Ophio5|4912
ATGGCTTCGTGGTACTCGTCCATACTCACAAAGACGACGTCGCACATTTCCTCCCTTCGCGCCACGCTTCTCTCG
TCCGACGCAGACGGCGAAGACGACGACGACACACACGTCTGTCGCGTCCTGCGCAACTATTACACAGACAAGGGC
CGACCCCTCCCTTCCTGGCTCCCCCCCGATCCCAAAGCTCCGGCAGCGGCGCCTGCACCAGCGGCCCCACAACAG
CCAGCCGTCGGATCGCGATACGGGGCACGAGCACAACAGCAGCAACAACAGCAGAGTGGTGGAGGACTCAGCAGT
CTATGGGATAGCAGTGGCGGCGCACAACAACGAAGCAACGACTTGGCACCGCCTCGACCGGACATGCCCAACCAG
CGAGCAGGCTCCTACCAGGCGTCCGCTTCGGCCCAGGATCGGCTCCGGCAGAGGTTGAGGGCTTCGGCCGGACCA
GGGGGGGCTCGTACGGCGAGTCCGCAGGGGCCGAATGGGCCGTTTGCACCCCCGGCGGCTGAGTCGGTGGCTTCG
CCTCGGCGCGTGCAGGGTTTACCTTTGGATCCGAGACGGCCGGGGGGGCCGAGGGGGTATCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail