Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4911
Gene name
Locationscaffold_396:2280..4926
Strand+
Gene length (bp)2646
Transcript length (bp)2259
Coding sequence length (bp)2256
Protein length (aa) 752

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 1.3E-33 425 670

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BU76|GYP7_DEBHA GTPase-activating protein GYP7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GYP7 PE=3 SV=2 38 751 0.0E+00
sp|Q9UUH7|GYP7_SCHPO GTPase-activating protein gyp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp7 PE=3 SV=1 38 748 0.0E+00
sp|P09379|GYP7_YARLI GTPase-activating protein GYP7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GYP7 PE=3 SV=2 46 752 0.0E+00
sp|Q6FWI1|GYP7_CANGA GTPase-activating protein GYP7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GYP7 PE=3 SV=1 37 752 1.0E-154
sp|P48365|GYP7_YEAST GTPase-activating protein GYP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP7 PE=1 SV=1 39 715 1.0E-142
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BU76|GYP7_DEBHA GTPase-activating protein GYP7 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GYP7 PE=3 SV=2 38 751 0.0E+00
sp|Q9UUH7|GYP7_SCHPO GTPase-activating protein gyp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp7 PE=3 SV=1 38 748 0.0E+00
sp|P09379|GYP7_YARLI GTPase-activating protein GYP7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GYP7 PE=3 SV=2 46 752 0.0E+00
sp|Q6FWI1|GYP7_CANGA GTPase-activating protein GYP7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GYP7 PE=3 SV=1 37 752 1.0E-154
sp|P48365|GYP7_YEAST GTPase-activating protein GYP7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP7 PE=1 SV=1 39 715 1.0E-142
sp|Q9CXF4|TBC15_MOUSE TBC1 domain family member 15 OS=Mus musculus GN=Tbc1d15 PE=1 SV=1 374 702 1.0E-66
sp|Q8TC07|TBC15_HUMAN TBC1 domain family member 15 OS=Homo sapiens GN=TBC1D15 PE=1 SV=2 374 742 5.0E-66
sp|Q9HA65|TBC17_HUMAN TBC1 domain family member 17 OS=Homo sapiens GN=TBC1D17 PE=1 SV=2 37 732 4.0E-60
sp|Q8BYH7|TBC17_MOUSE TBC1 domain family member 17 OS=Mus musculus GN=Tbc1d17 PE=1 SV=2 374 706 8.0E-59
sp|Q8TBP0|TBC16_HUMAN TBC1 domain family member 16 OS=Homo sapiens GN=TBC1D16 PE=2 SV=1 394 709 5.0E-34
sp|Q80U12|SGSM2_MOUSE Small G protein signaling modulator 2 OS=Mus musculus GN=Sgsm2 PE=1 SV=2 487 711 5.0E-33
sp|Q2NKQ1|SGSM1_HUMAN Small G protein signaling modulator 1 OS=Homo sapiens GN=SGSM1 PE=1 SV=2 487 711 6.0E-33
sp|O43147|SGSM2_HUMAN Small G protein signaling modulator 2 OS=Homo sapiens GN=SGSM2 PE=1 SV=4 487 711 1.0E-32
sp|Q8BPQ7|SGSM1_MOUSE Small G protein signaling modulator 1 OS=Mus musculus GN=Sgsm1 PE=1 SV=2 487 711 1.0E-32
sp|Q3MII6|TBC25_HUMAN TBC1 domain family member 25 OS=Homo sapiens GN=TBC1D25 PE=1 SV=2 378 646 2.0E-29
sp|A1A5B6|TBC25_MOUSE TBC1 domain family member 25 OS=Mus musculus GN=Tbc1d25 PE=1 SV=1 378 646 3.0E-29
sp|Q8IYX1|TBC21_HUMAN TBC1 domain family member 21 OS=Homo sapiens GN=TBC1D21 PE=2 SV=1 383 694 2.0E-18
sp|Q9NVG8|TBC13_HUMAN TBC1 domain family member 13 OS=Homo sapiens GN=TBC1D13 PE=1 SV=3 520 670 2.0E-11
sp|Q8R3D1|TBC13_MOUSE TBC1 domain family member 13 OS=Mus musculus GN=Tbc1d13 PE=1 SV=1 520 670 2.0E-11
sp|Q8BM85|TBCK_MOUSE TBC domain-containing protein kinase-like protein OS=Mus musculus GN=Tbck PE=1 SV=1 542 728 2.0E-07
sp|Q5F361|TBCK_CHICK TBC domain-containing protein kinase-like protein OS=Gallus gallus GN=TBCK PE=2 SV=2 542 704 2.0E-07
sp|O59737|GYP1_SCHPO GTPase-activating protein gyp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp1 PE=3 SV=1 426 699 2.0E-07
sp|Q8TEA7|TBCK_HUMAN TBC domain-containing protein kinase-like protein OS=Homo sapiens GN=TBCK PE=1 SV=4 542 703 2.0E-06
sp|Q9URY3|YLOH_SCHPO TBC domain-containing protein C1952.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1952.17c PE=3 SV=4 524 653 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4911
MADSRPPASPSASFDALSDDEEGGYDTVTLSESARRGVKLLFAKSKVYAHPTPSARDNIAGYIALLQQKSTARPS
SASSSSSSSPASSDLLLAWLPESTLADSASLYAKADLSDQHSPSTYPYLVPPPPTVTTHSGSVGGYSFAVPLSAI
FSLHVRPPNTGWWHGSVIIHARNGHGAFPALFFHDNECQSTTMQKKRLAHDSFDPFSEGGHMFWGADEVLRWLRR
YVPVERSGAEPNVYLIDPSSEDVESFGRNSAAAAAASTSAAADAQDPLVKFVKETGWSIMNQFSKVTTLTRRAAQ
DLADNSNVPPQVRRLLRNPEVQTLQNEFDSARIYLARWAMGIAEQSERDRRGRVWTARDVAELEDSDVGEFELVD
VGGLSVEERRRPVTAVEWAGWFDEAGRLSVTVDEVKERVFHGGLDPDDGVRKEAWLFLLGVYEWHGTADERRAQE
ASLRDQYYRLKQAWWYRLDGQGGEGEEGEWWREQRGRIEKDVHRTDRNIPLFQGEDTPHPDPNSPFYDVGTNSHL
EQLKEMLLTYNEHNRSLGYVQGMSDLLSPLYATISDDALAFWAFEHFMQRMQRNFLRDQSGMRAQLVTLDQLVNL
MDPKLWAHLNKADSTNFFFFFRMLLVWYKREFCWADVLALWERLWTDWCSAEMSLFVALAILEKHRDVIMGHLVA
FDEVLKYVNELSNTMDLESTLIRAESLFRKFQRLVDAVDKRNNFPPPPSTSSSSPPAGDDAPRVITPELRRLLSR
EA
Coding >Ophio5|4911
ATGGCCGACTCGCGGCCCCCCGCGTCGCCTTCGGCCAGCTTCGACGCCCTCAGCGACGACGAAGAAGGCGGCTAC
GATACCGTCACCCTCTCCGAATCCGCTCGTCGCGGCGTCAAGCTTCTCTTCGCAAAGAGCAAAGTCTATGCCCAT
CCTACGCCCTCTGCTAGAGACAACATCGCCGGTTACATTGCGCTGCTGCAGCAGAAGTCGACGGCGCGACCGTCA
TCGGCATCGTCGTCGTCTTCTTCGTCGCCTGCTTCCTCAGACCTGCTCCTCGCATGGCTGCCCGAGTCAACGTTG
GCTGACTCGGCATCTCTCTACGCAAAAGCCGACCTCTCTGATCAACACTCGCCTTCGACGTATCCCTATCTCGTG
CCGCCCCCTCCGACGGTGACGACACATTCTGGCTCCGTCGGCGGATACTCCTTTGCCGTGCCTCTCAGTGCCATC
TTCTCGCTGCATGTCCGTCCGCCCAACACTGGCTGGTGGCATGGCTCCGTCATTATCCACGCGCGCAACGGCCAT
GGAGCCTTCCCTGCTCTCTTCTTCCACGATAACGAGTGTCAGAGCACAACGATGCAGAAGAAGCGTCTCGCCCAC
GACTCCTTTGACCCTTTCAGCGAGGGCGGACACATGTTTTGGGGCGCCGACGAGGTTCTGCGTTGGCTTCGTCGT
TACGTCCCCGTCGAGCGATCCGGTGCCGAGCCCAATGTTTACCTGATCGATCCCAGCAGCGAAGACGTCGAGTCC
TTTGGACGGAATTCTGCCGCCGCAGCAGCCGCCTCTACCTCGGCAGCGGCCGACGCCCAAGATCCGCTGGTCAAG
TTCGTCAAGGAGACAGGCTGGAGCATCATGAACCAATTCAGCAAAGTCACGACGCTTACCCGCCGTGCGGCTCAA
GACCTGGCCGACAACTCCAACGTCCCGCCCCAAGTGCGCCGCCTCCTGCGCAACCCCGAGGTGCAGACTCTGCAG
AACGAATTCGATAGCGCGCGCATCTACCTCGCCCGCTGGGCCATGGGCATCGCCGAACAGAGCGAGCGCGATCGT
CGAGGCCGCGTCTGGACGGCGCGTGACGTGGCCGAGCTCGAAGACAGCGACGTCGGCGAGTTTGAGCTTGTCGAC
GTCGGCGGCCTCTCGGTCGAGGAGAGGAGAAGGCCTGTGACGGCGGTCGAGTGGGCTGGCTGGTTTGACGAGGCC
GGCAGGCTGTCGGTCACGGTCGACGAGGTCAAGGAGCGCGTCTTTCACGGAGGGCTGGATCCCGACGATGGTGTT
CGAAAGGAGGCTTGGCTGTTCCTCCTCGGCGTCTACGAGTGGCATGGCACCGCTGACGAGAGAAGGGCGCAAGAG
GCGTCGCTGCGGGATCAGTACTATCGTCTCAAGCAGGCCTGGTGGTATCGTCTCGACGGCCAGGGAGGAGAGGGC
GAGGAGGGCGAGTGGTGGCGGGAGCAGAGGGGGCGAATCGAGAAAGACGTCCACCGAACAGACCGCAACATCCCC
CTCTTCCAAGGCGAAGACACCCCCCACCCGGACCCAAACTCCCCCTTCTACGACGTCGGCACCAACAGCCACCTC
GAACAGCTCAAGGAGATGCTGCTGACGTACAACGAACACAACCGTAGCCTGGGCTACGTCCAAGGCATGTCGGAC
CTGCTCTCGCCCCTGTACGCGACCATCTCGGACGACGCGCTCGCCTTCTGGGCCTTTGAGCACTTCATGCAGCGC
ATGCAGCGCAACTTTCTGCGCGACCAGTCCGGCATGCGCGCCCAGCTCGTCACCCTCGACCAGCTCGTCAACCTG
ATGGATCCCAAGCTGTGGGCCCACCTCAACAAGGCCGACAGCACAAACTTCTTCTTCTTCTTCCGAATGCTCCTC
GTCTGGTACAAGAGGGAGTTTTGCTGGGCCGACGTCTTGGCCCTCTGGGAGAGGCTGTGGACCGATTGGTGCTCG
GCCGAGATGTCCCTCTTTGTCGCCTTGGCTATACTGGAGAAGCATCGGGATGTCATCATGGGCCATCTTGTGGCC
TTTGACGAGGTGCTGAAATACGTAAACGAACTCTCCAACACAATGGACCTCGAATCGACCCTCATCCGAGCCGAA
TCCCTCTTTCGCAAATTTCAGCGCCTCGTCGACGCCGTCGACAAGCGGAACAACTTCCCTCCCCCACCTTCTACT
TCTTCTTCTTCTCCCCCTGCTGGGGACGATGCACCGAGGGTTATTACTCCCGAGTTGAGGAGGTTGCTTAGTCGT
GAGGCT
Transcript >Ophio5|4911
ATGGCCGACTCGCGGCCCCCCGCGTCGCCTTCGGCCAGCTTCGACGCCCTCAGCGACGACGAAGAAGGCGGCTAC
GATACCGTCACCCTCTCCGAATCCGCTCGTCGCGGCGTCAAGCTTCTCTTCGCAAAGAGCAAAGTCTATGCCCAT
CCTACGCCCTCTGCTAGAGACAACATCGCCGGTTACATTGCGCTGCTGCAGCAGAAGTCGACGGCGCGACCGTCA
TCGGCATCGTCGTCGTCTTCTTCGTCGCCTGCTTCCTCAGACCTGCTCCTCGCATGGCTGCCCGAGTCAACGTTG
GCTGACTCGGCATCTCTCTACGCAAAAGCCGACCTCTCTGATCAACACTCGCCTTCGACGTATCCCTATCTCGTG
CCGCCCCCTCCGACGGTGACGACACATTCTGGCTCCGTCGGCGGATACTCCTTTGCCGTGCCTCTCAGTGCCATC
TTCTCGCTGCATGTCCGTCCGCCCAACACTGGCTGGTGGCATGGCTCCGTCATTATCCACGCGCGCAACGGCCAT
GGAGCCTTCCCTGCTCTCTTCTTCCACGATAACGAGTGTCAGAGCACAACGATGCAGAAGAAGCGTCTCGCCCAC
GACTCCTTTGACCCTTTCAGCGAGGGCGGACACATGTTTTGGGGCGCCGACGAGGTTCTGCGTTGGCTTCGTCGT
TACGTCCCCGTCGAGCGATCCGGTGCCGAGCCCAATGTTTACCTGATCGATCCCAGCAGCGAAGACGTCGAGTCC
TTTGGACGGAATTCTGCCGCCGCAGCAGCCGCCTCTACCTCGGCAGCGGCCGACGCCCAAGATCCGCTGGTCAAG
TTCGTCAAGGAGACAGGCTGGAGCATCATGAACCAATTCAGCAAAGTCACGACGCTTACCCGCCGTGCGGCTCAA
GACCTGGCCGACAACTCCAACGTCCCGCCCCAAGTGCGCCGCCTCCTGCGCAACCCCGAGGTGCAGACTCTGCAG
AACGAATTCGATAGCGCGCGCATCTACCTCGCCCGCTGGGCCATGGGCATCGCCGAACAGAGCGAGCGCGATCGT
CGAGGCCGCGTCTGGACGGCGCGTGACGTGGCCGAGCTCGAAGACAGCGACGTCGGCGAGTTTGAGCTTGTCGAC
GTCGGCGGCCTCTCGGTCGAGGAGAGGAGAAGGCCTGTGACGGCGGTCGAGTGGGCTGGCTGGTTTGACGAGGCC
GGCAGGCTGTCGGTCACGGTCGACGAGGTCAAGGAGCGCGTCTTTCACGGAGGGCTGGATCCCGACGATGGTGTT
CGAAAGGAGGCTTGGCTGTTCCTCCTCGGCGTCTACGAGTGGCATGGCACCGCTGACGAGAGAAGGGCGCAAGAG
GCGTCGCTGCGGGATCAGTACTATCGTCTCAAGCAGGCCTGGTGGTATCGTCTCGACGGCCAGGGAGGAGAGGGC
GAGGAGGGCGAGTGGTGGCGGGAGCAGAGGGGGCGAATCGAGAAAGACGTCCACCGAACAGACCGCAACATCCCC
CTCTTCCAAGGCGAAGACACCCCCCACCCGGACCCAAACTCCCCCTTCTACGACGTCGGCACCAACAGCCACCTC
GAACAGCTCAAGGAGATGCTGCTGACGTACAACGAACACAACCGTAGCCTGGGCTACGTCCAAGGCATGTCGGAC
CTGCTCTCGCCCCTGTACGCGACCATCTCGGACGACGCGCTCGCCTTCTGGGCCTTTGAGCACTTCATGCAGCGC
ATGCAGCGCAACTTTCTGCGCGACCAGTCCGGCATGCGCGCCCAGCTCGTCACCCTCGACCAGCTCGTCAACCTG
ATGGATCCCAAGCTGTGGGCCCACCTCAACAAGGCCGACAGCACAAACTTCTTCTTCTTCTTCCGAATGCTCCTC
GTCTGGTACAAGAGGGAGTTTTGCTGGGCCGACGTCTTGGCCCTCTGGGAGAGGCTGTGGACCGATTGGTGCTCG
GCCGAGATGTCCCTCTTTGTCGCCTTGGCTATACTGGAGAAGCATCGGGATGTCATCATGGGCCATCTTGTGGCC
TTTGACGAGGTGCTGAAATACGTAAACGAACTCTCCAACACAATGGACCTCGAATCGACCCTCATCCGAGCCGAA
TCCCTCTTTCGCAAATTTCAGCGCCTCGTCGACGCCGTCGACAAGCGGAACAACTTCCCTCCCCCACCTTCTACT
TCTTCTTCTTCTCCCCCTGCTGGGGACGATGCACCGAGGGTTATTACTCCCGAGTTGAGGAGGTTGCTTAGTCGT
GAGGCTTGA
Gene >Ophio5|4911
ATGGCCGACTCGCGGCCCCCCGCGTCGCCTTCGGCCAGCTTCGACGCCCTCAGCGACGACGAAGAAGGCGGCTAC
GATACCGTCACCCTCTCCGAATCCGCTCGTCGCGGCGTCAAGCTTCTCTTCGCAAAGAGCAAAGTCTATGCCCAT
CCTACGCCCTCTGCTAGAGACAACATCGCCGGTTACATTGCGCTGCTGCAGCAGAAGTCGACGGCGCGACCGTCA
TCGGCATCGTCGTCGTCTTCTTCGTCGCCTGCTTCCTCAGACCTGCTCCTCGCATGGCTGCCCGAGTCAACGTTG
GCTGACTCGGCATCTCTCTACGCAAAAGCCGACCTCTCTGATCAACACTCGCCTTCGACGTATCCCTATCTCGTG
CCGCCCCCTCCGACGGTGACGACACATTCTGGCTCCGTCGGCGGATACTCCTTTGCCGTGCCTCTCAGTGCCATC
TTCTCGCTGCATGTCCGTCCGCCCAACACTGGCTGGTGGCATGGCTCCGTCATTATCCACGCGCGCAACGGCCAT
GGAGCCTTCCCTGCTCTCTTCTTCCACGATAACGAGTGTCAGAGCACAACGATGCAGAAGAAGCGTCTCGCCCAC
GACTCCTTTGACCCTTTCAGCGAGGGCGGACACATGTTTTGGGGCGCCGACGAGGTTCTGCGTTGGCTTCGTCGT
TACGTCCCCGTCGAGCGATCCGGTGCCGAGCCCAATGTTTACCTGATCGATCCCAGCAGCGAAGACGTCGAGTCC
TTTGGACGGAATTCTGCCGCCGCAGCAGCCGCCTCTACCTCGGCAGCGGCCGACGCCCAAGATCCGCTGGTCAAG
TTCGTCAAGGAGACAGGCTGGAGCATCATGAACCAATTCAGCAAAGTCACGACGCTTACCCGCCGTGCGGCTCAA
GACCTGGCCGACAACTCCAACGTCCCGCCCCAAGTGCGCCGCCTCCTGCGCAACCCCGAGGTGCAGACTCTGCAG
AACGAATTCGATAGCGCGCGCATCTACCTCGCCCGCTGGGCCATGGGCATCGCCGAACAGAGCGAGCGCGATCGT
CGAGGCCGCGTCTGGACGGCGCGTGACGTGGCCGAGCTCGAAGACAGCGACGTCGGCGAGTTTGAGCTTGTCGAC
GTCGGCGGCCTCTCGGTCGAGGAGAGGAGAAGGCCTGTGACGGCGGTCGAGTGGGCTGGCTGGTTTGACGAGGCC
GGCAGGCTGTCGGTCACGGTCGACGAGGTCAAGGAGCGCGTCTTTCACGGAGGGCTGGATCCCGACGATGGTGTT
CGAAAGGAGGCTTGGCTGTTCCTCCTCGGCGTCTACGAGTGGCATGGCACCGCTGACGAGAGAAGGGCGCAAGAG
GCGTCGCTGCGGGATCAGTACTATCGTCTCAAGCAGGCCTGGTGGTATCGTCTCGACGGCCAGGGAGGAGAGGGC
GAGGAGGGCGAGTGGTGGCGGGAGCAGAGGGGGCGAATCGGTGAGTATTGGAACGGCCAAAACCCCTATTTATCC
CCCGTCAACAGCTAACAAACCTTTACAGAGAAAGACGTCCACCGAACAGACCGCAACATCCCCCTCTTCCAAGGC
GAAGACACCCCCCACCCGGACCCAAACTCCCCCTTCTACGACGTCGGCACCAACAGCCACCTCGAACAGCTCAAG
GAGATGCTGCTGACGTACAACGAACACAACCGTAGCCTGGGCTACGTCCAAGGCATGTCGGACCTGCTCTCGCCC
CTGTACGCGACCATCTCGGACGACGCGCTCGCCTTCTGGGCCTTTGAGCACTTCATGCAGCGCATGCAGCGCAAC
TTTCTGCGCGACCAGTCCGGCATGCGCGCCCAGCTCGTCACCCTCGACCAGCTCGTCAACCTGATGGATCCCAAG
CTGTGGGCCCACCTCAACAAGGCCGACAGCACAAACTTCTTCTTCTTCTTCCGAATGCTCCTCGTCTGGTACAAG
AGGGAGTTTTGCTGGGCCGACGTCTTGGCCCTCTGGGAGAGGCTGTGGACCGATTGGTGCTCGGCCGAGATGTCC
CTCTTTGTCGCCTTGGCTATACTGGAGAAGCATCGGGATGTCATCATGGGCCATCTTGTGGCCTTTGACGAGGTG
CTGAAATACGGTCAGTTTCGTTTCTTTTTTTTCCTTGTCCTGTTTGTTTTCCTCTCTTCTCTTCTTTTCTCTTCT
CTTCTCTTCTCCTCTCCTCTCTTTTCTTTTCTTCTCGCCTCCCCTGTTCTCTCTCTTCTCTCCATCCTCCCCTCT
TCCCCCCATCTTCCCCCTTTCCTGTCTTTTTTTCCCCCGTCCCCTTTTCCTCTCGTTTTTCTCATCTTCTTTTCC
CCCTCCCCATGGTTTCTTCATCTCTTACCACCCCCCCCTTAATTTTTACTTGATCTTCGTTTTTCATTATCTCTT
TCTAACAATGTCACCCCCCTGCTAACGAGAGCAGTAAACGAACTCTCCAACACAATGGACCTCGAATCGACCCTC
ATCCGAGCCGAATCCCTCTTTCGCAAATTTCAGCGCCTCGTCGACGCCGTCGACAAGCGGAACAACTTCCCTCCC
CCACCTTCTACTTCTTCTTCTTCTCCCCCTGCTGGGGACGATGCACCGAGGGTTATTACTCCCGAGTTGAGGAGG
TTGCTTAGTCGTGAGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail