Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4909
Gene name
Locationscaffold_395:15537..19143
Strand+
Gene length (bp)3606
Transcript length (bp)3492
Coding sequence length (bp)3489
Protein length (aa) 1163

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.2E-06 895 966
PF20174 DUF6540 Family of unknown function (DUF6540) 4.7E-09 40 158

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 893 1040 8.0E-12
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 895 1045 2.0E-10
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 895 1045 2.0E-10
sp|Q5T7N3|KANK4_HUMAN KN motif and ankyrin repeat domain-containing protein 4 OS=Homo sapiens GN=KANK4 PE=2 SV=1 903 1040 2.0E-09
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 895 1045 5.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 893 1040 8.0E-12
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 895 1045 2.0E-10
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 895 1045 2.0E-10
sp|Q5T7N3|KANK4_HUMAN KN motif and ankyrin repeat domain-containing protein 4 OS=Homo sapiens GN=KANK4 PE=2 SV=1 903 1040 2.0E-09
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 895 1045 5.0E-09
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 895 1040 9.0E-09
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 891 1045 4.0E-08
sp|Q6P9J5|KANK4_MOUSE KN motif and ankyrin repeat domain-containing protein 4 OS=Mus musculus GN=Kank4 PE=1 SV=1 903 1040 4.0E-08
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 895 1045 4.0E-08
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 900 1040 5.0E-08
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 895 1045 6.0E-08
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 895 1040 8.0E-08
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 900 1042 9.0E-08
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 880 1010 1.0E-07
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 904 1045 3.0E-07
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 904 1045 4.0E-07
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 894 1010 9.0E-07
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 898 1010 1.0E-06
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 898 1010 2.0E-06
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 898 1010 2.0E-06
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 895 1032 2.0E-06
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 898 1010 2.0E-06
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 888 1039 2.0E-06
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 898 1010 2.0E-06
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 898 1010 2.0E-06
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 898 1010 2.0E-06
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 898 1010 2.0E-06
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 867 1045 3.0E-06
sp|Q1RJR6|Y317_RICBR Putative ankyrin repeat protein RBE_0317 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0317 PE=3 SV=1 824 1040 3.0E-06
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 907 1028 4.0E-06
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 905 1045 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Plastid Chloroplast transit peptide 0.2855 0.1557 0.1394 0.0514 0.2428 0.8651 0.1005 0.0732 0.1004 0.0804

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup842
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6267
Ophiocordyceps camponoti-floridani Ophcf2|05332
Ophiocordyceps camponoti-rufipedis Ophun1|5834
Ophiocordyceps kimflemingae Ophio5|1491
Ophiocordyceps kimflemingae Ophio5|4909 (this protein)
Ophiocordyceps subramaniannii Hirsu2|4527
Ophiocordyceps subramaniannii Hirsu2|8822

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4909
MERGNRLEKKRSISFADNRRRVQIALYARSDHSFGPARHRGGYESYHWAILVSPKRPRGKDVDAYDVTDNVIVDP
ETHKNLNPSRQFYLQIKRGVTPTSSTKLVGRVSLCKLKDSVTQDDLEAIIRRVPIPNKLANPPQSCVTWARNAIA
ELQDAGLLRSFDLDKFSNWALRFADKGRSKLGTSKQYEHVVEYGEREEKEVIWDTEPYDDYVEYIYLVTSRTTEE
IHEAKGIFPQGYSPYLSASGEAPVIPDLDVPFGGAIDMVPNTAYLRAYKRFGTAGMIAINRAGSEPLRIWKIKTT
QNMIPENSIGGFWSEEEAFLILGGVHLGQMRGYYEIDVMRERVSGRFRDTHRPPHPSDDPFHENLLYRKDIFAKE
QHIRLSELTLRHKANLRGLLLLPACRTPPLHGPLVVRRTAARCAWTDDSDAGTGGLTTSVDDDLLPSALPDYDSM
EGLDGETIVFPGLRMPMQGEMEPMDDEEMTQLVNRLAMEETLALMDRLGFHVAVTAKETLDGIFEFRLRMRRHRA
IESSMQSMTMPAVTSTPAVRTRLWGATAAMSLAALPFYFRDVAGIFHTKMRIWDQVAVAMSIVPVIGCAAQTVAD
AQNGMVPVLPSMLCFVGDILLFTTASLMGLLVRSIGALMEEEEKHGVDYILLSHDQGWNEHFDQVKAYLDSAEWT
AKMTSQFLRETALIVFAVAEQKSLLEASKLLLQRNGVSDRERKQAEQVMDALYNETLRTMCVKIRERKRWFQMDL
PLGVVKWVRDQAQHYNDEFLSRYRAVMEKEYAAKVHVQSMREGRFPVHWQWKEKQRREFEDKVDDISHHVSRRGS
HHFNESVIIELVRSYASRELMLPSECSCVTEVYEVERILDEQLLWPEKSLAETLSDQLSCSMSSSQERVIIRLLT
TGRLDANAQDDNGNTALTRASAQGNVGVVRAVLKSGMARLNLRNHDGDTALLLAAGAGHANIVEMLGNQVWKTER
RMDMNVRSRDGGDTALTLAAENMDEEVVKKLMLTGHVLTELVNHNNESALDIAERKGYHRIARLIRQRAAIYVDD
PPPPDLNVFPWTSEPPVFWPRRAVELEPGLFGGGEVAIYRLNTGERWRNDTGQFWDEESEDWVFKEGVATPDLSM
SVPSEEVEPSESELTGGPGPRPVVEPAVEPPETEGPKL
Coding >Ophio5|4909
ATGGAAAGAGGCAACCGGTTGGAGAAGAAGCGTTCCATTTCCTTCGCGGACAACAGACGACGGGTGCAAATCGCC
CTGTACGCCCGTAGCGACCACTCGTTCGGTCCGGCTCGGCACAGGGGAGGCTACGAGTCCTACCACTGGGCCATC
CTCGTCAGCCCCAAGCGTCCGAGGGGAAAGGACGTCGACGCATACGACGTGACGGACAACGTGATTGTGGACCCC
GAGACTCATAAGAATCTCAACCCTTCTCGTCAATTCTACTTGCAGATCAAGCGAGGAGTCACACCGACGTCATCG
ACGAAGCTGGTCGGGCGCGTCAGCCTTTGCAAGCTGAAAGATTCTGTCACGCAAGACGATCTTGAGGCCATCATT
AGACGGGTGCCAATTCCGAACAAGCTCGCCAACCCGCCGCAGAGTTGCGTCACCTGGGCTCGCAACGCGATAGCC
GAGTTACAGGATGCCGGCCTGCTTCGATCATTTGACTTGGACAAGTTCAGCAACTGGGCCCTCCGTTTCGCCGAT
AAAGGCCGGTCCAAGCTGGGTACGTCGAAGCAGTATGAGCACGTGGTCGAGTATGGCGAAAGGGAAGAAAAGGAG
GTCATATGGGACACGGAACCGTACGACGATTACGTCGAGTACATCTACCTGGTCACGTCGCGGACGACCGAGGAG
ATTCACGAGGCCAAGGGCATCTTTCCGCAAGGCTACTCGCCCTACCTGTCGGCTTCCGGAGAGGCCCCCGTGATC
CCGGACTTGGACGTGCCGTTTGGGGGCGCCATCGACATGGTGCCCAATACGGCCTATCTACGGGCGTACAAGAGG
TTCGGGACGGCGGGCATGATTGCCATCAACCGGGCCGGCTCGGAGCCGCTTCGGATATGGAAGATCAAGACGACG
CAAAACATGATTCCCGAGAACAGCATCGGAGGCTTCTGGAGCGAGGAGGAGGCCTTTCTCATCCTCGGCGGCGTT
CATCTCGGTCAGATGAGAGGATACTACGAGATAGACGTGATGAGAGAGCGTGTCAGCGGCCGCTTCCGCGACACG
CACCGGCCGCCGCATCCTTCCGACGACCCGTTCCACGAGAACTTGCTGTACCGGAAAGACATCTTCGCCAAAGAG
CAGCACATCCGGCTCAGCGAGCTGACTCTCCGTCACAAGGCGAACCTGAGGGGCCTGCTACTGCTGCCGGCGTGC
CGAACCCCCCCGCTTCACGGCCCCCTTGTAGTCAGGCGGACGGCGGCGCGTTGTGCGTGGACGGACGATAGCGAC
GCAGGCACGGGTGGCTTGACGACATCCGTCGACGACGACTTGCTCCCCTCAGCTTTGCCGGATTATGATTCGATG
GAAGGCCTCGACGGCGAGACGATTGTGTTTCCGGGTCTGAGGATGCCTATGCAGGGGGAGATGGAGCCCATGGAC
GACGAGGAGATGACGCAGCTGGTCAACAGGCTCGCCATGGAGGAGACGTTGGCGCTCATGGACAGGCTAGGCTTC
CATGTGGCGGTGACGGCCAAGGAAACGTTGGACGGCATCTTCGAATTCAGACTCCGGATGCGGCGTCACCGGGCC
ATCGAATCAAGTATGCAGTCCATGACGATGCCAGCCGTGACGTCGACGCCGGCGGTCAGGACCAGGCTGTGGGGG
GCGACGGCGGCCATGTCGTTGGCAGCGCTGCCGTTTTACTTTAGGGACGTGGCCGGCATTTTCCACACCAAGATG
AGGATCTGGGACCAGGTGGCGGTGGCCATGTCCATCGTGCCCGTCATCGGCTGTGCCGCCCAGACGGTGGCGGAC
GCCCAGAACGGCATGGTGCCCGTGTTGCCGTCGATGCTGTGCTTCGTAGGCGACATCCTCCTTTTCACGACGGCG
TCGCTCATGGGCTTGCTGGTGCGTTCGATCGGGGCCCTGATGGAGGAGGAGGAGAAGCACGGGGTCGACTATATC
CTGCTCTCGCACGACCAGGGATGGAACGAGCATTTCGACCAGGTCAAGGCCTACCTCGACTCGGCCGAGTGGACG
GCCAAGATGACGAGTCAGTTCCTGCGCGAGACGGCCTTGATCGTCTTCGCCGTGGCGGAGCAGAAGAGCCTGCTG
GAAGCGAGCAAGTTGCTGTTGCAAAGGAACGGCGTCTCGGACCGAGAGCGGAAACAGGCCGAGCAGGTCATGGAC
GCGCTGTACAACGAGACGCTGCGTACCATGTGCGTCAAGATCAGGGAGAGGAAGCGTTGGTTTCAGATGGATCTA
CCGCTCGGCGTCGTCAAATGGGTGCGAGACCAAGCCCAGCACTACAACGACGAATTCCTGAGCCGGTATCGGGCC
GTCATGGAGAAGGAGTACGCGGCCAAGGTGCATGTGCAGTCTATGCGCGAGGGTCGGTTTCCCGTCCACTGGCAG
TGGAAGGAGAAGCAACGGCGCGAGTTCGAGGACAAGGTCGACGACATCAGCCATCACGTCAGTCGACGCGGCTCG
CACCATTTCAACGAGTCTGTCATTATCGAACTCGTCCGGTCGTACGCCAGTCGGGAGCTCATGCTTCCGAGCGAG
TGTAGCTGCGTGACCGAGGTGTACGAGGTCGAGAGGATACTGGACGAACAGCTGCTGTGGCCGGAGAAGAGCCTG
GCGGAGACGCTGAGCGACCAGCTGTCGTGCTCCATGTCGAGCTCTCAGGAGAGAGTCATCATCCGACTCCTGACG
ACCGGACGACTCGACGCCAACGCCCAGGACGACAACGGCAACACGGCTCTCACCCGGGCCTCGGCCCAGGGCAAC
GTCGGCGTAGTCCGAGCCGTACTCAAGTCCGGCATGGCTCGTCTCAACCTGCGCAACCACGACGGCGATACGGCC
CTCCTGCTGGCTGCCGGAGCGGGACACGCCAACATTGTCGAGATGCTGGGCAACCAGGTGTGGAAGACGGAGCGC
AGGATGGACATGAACGTGCGCAGCCGAGACGGCGGAGACACGGCCCTGACGCTGGCCGCCGAGAACATGGACGAG
GAAGTGGTCAAGAAGTTGATGCTGACCGGACACGTCCTGACCGAGCTGGTCAACCACAACAACGAGTCGGCGCTG
GACATTGCCGAGAGAAAGGGCTACCATCGGATCGCCAGGCTGATCCGCCAGCGGGCCGCCATCTACGTAGACGAC
CCGCCGCCACCGGACCTCAACGTTTTCCCCTGGACGTCGGAGCCGCCGGTGTTCTGGCCGCGGAGGGCGGTCGAG
CTGGAGCCCGGCCTCTTCGGAGGAGGAGAGGTGGCCATCTATCGGCTCAACACGGGCGAGCGGTGGCGCAACGAC
ACGGGACAGTTTTGGGATGAGGAATCGGAGGACTGGGTCTTCAAGGAAGGCGTCGCTACCCCGGATCTCTCCATG
TCGGTGCCCTCCGAGGAGGTGGAGCCGTCGGAGTCGGAATTGACAGGTGGGCCGGGGCCGAGGCCGGTGGTGGAA
CCTGCGGTGGAGCCACCGGAGACGGAGGGCCCGAAGCTC
Transcript >Ophio5|4909
ATGGAAAGAGGCAACCGGTTGGAGAAGAAGCGTTCCATTTCCTTCGCGGACAACAGACGACGGGTGCAAATCGCC
CTGTACGCCCGTAGCGACCACTCGTTCGGTCCGGCTCGGCACAGGGGAGGCTACGAGTCCTACCACTGGGCCATC
CTCGTCAGCCCCAAGCGTCCGAGGGGAAAGGACGTCGACGCATACGACGTGACGGACAACGTGATTGTGGACCCC
GAGACTCATAAGAATCTCAACCCTTCTCGTCAATTCTACTTGCAGATCAAGCGAGGAGTCACACCGACGTCATCG
ACGAAGCTGGTCGGGCGCGTCAGCCTTTGCAAGCTGAAAGATTCTGTCACGCAAGACGATCTTGAGGCCATCATT
AGACGGGTGCCAATTCCGAACAAGCTCGCCAACCCGCCGCAGAGTTGCGTCACCTGGGCTCGCAACGCGATAGCC
GAGTTACAGGATGCCGGCCTGCTTCGATCATTTGACTTGGACAAGTTCAGCAACTGGGCCCTCCGTTTCGCCGAT
AAAGGCCGGTCCAAGCTGGGTACGTCGAAGCAGTATGAGCACGTGGTCGAGTATGGCGAAAGGGAAGAAAAGGAG
GTCATATGGGACACGGAACCGTACGACGATTACGTCGAGTACATCTACCTGGTCACGTCGCGGACGACCGAGGAG
ATTCACGAGGCCAAGGGCATCTTTCCGCAAGGCTACTCGCCCTACCTGTCGGCTTCCGGAGAGGCCCCCGTGATC
CCGGACTTGGACGTGCCGTTTGGGGGCGCCATCGACATGGTGCCCAATACGGCCTATCTACGGGCGTACAAGAGG
TTCGGGACGGCGGGCATGATTGCCATCAACCGGGCCGGCTCGGAGCCGCTTCGGATATGGAAGATCAAGACGACG
CAAAACATGATTCCCGAGAACAGCATCGGAGGCTTCTGGAGCGAGGAGGAGGCCTTTCTCATCCTCGGCGGCGTT
CATCTCGGTCAGATGAGAGGATACTACGAGATAGACGTGATGAGAGAGCGTGTCAGCGGCCGCTTCCGCGACACG
CACCGGCCGCCGCATCCTTCCGACGACCCGTTCCACGAGAACTTGCTGTACCGGAAAGACATCTTCGCCAAAGAG
CAGCACATCCGGCTCAGCGAGCTGACTCTCCGTCACAAGGCGAACCTGAGGGGCCTGCTACTGCTGCCGGCGTGC
CGAACCCCCCCGCTTCACGGCCCCCTTGTAGTCAGGCGGACGGCGGCGCGTTGTGCGTGGACGGACGATAGCGAC
GCAGGCACGGGTGGCTTGACGACATCCGTCGACGACGACTTGCTCCCCTCAGCTTTGCCGGATTATGATTCGATG
GAAGGCCTCGACGGCGAGACGATTGTGTTTCCGGGTCTGAGGATGCCTATGCAGGGGGAGATGGAGCCCATGGAC
GACGAGGAGATGACGCAGCTGGTCAACAGGCTCGCCATGGAGGAGACGTTGGCGCTCATGGACAGGCTAGGCTTC
CATGTGGCGGTGACGGCCAAGGAAACGTTGGACGGCATCTTCGAATTCAGACTCCGGATGCGGCGTCACCGGGCC
ATCGAATCAAGTATGCAGTCCATGACGATGCCAGCCGTGACGTCGACGCCGGCGGTCAGGACCAGGCTGTGGGGG
GCGACGGCGGCCATGTCGTTGGCAGCGCTGCCGTTTTACTTTAGGGACGTGGCCGGCATTTTCCACACCAAGATG
AGGATCTGGGACCAGGTGGCGGTGGCCATGTCCATCGTGCCCGTCATCGGCTGTGCCGCCCAGACGGTGGCGGAC
GCCCAGAACGGCATGGTGCCCGTGTTGCCGTCGATGCTGTGCTTCGTAGGCGACATCCTCCTTTTCACGACGGCG
TCGCTCATGGGCTTGCTGGTGCGTTCGATCGGGGCCCTGATGGAGGAGGAGGAGAAGCACGGGGTCGACTATATC
CTGCTCTCGCACGACCAGGGATGGAACGAGCATTTCGACCAGGTCAAGGCCTACCTCGACTCGGCCGAGTGGACG
GCCAAGATGACGAGTCAGTTCCTGCGCGAGACGGCCTTGATCGTCTTCGCCGTGGCGGAGCAGAAGAGCCTGCTG
GAAGCGAGCAAGTTGCTGTTGCAAAGGAACGGCGTCTCGGACCGAGAGCGGAAACAGGCCGAGCAGGTCATGGAC
GCGCTGTACAACGAGACGCTGCGTACCATGTGCGTCAAGATCAGGGAGAGGAAGCGTTGGTTTCAGATGGATCTA
CCGCTCGGCGTCGTCAAATGGGTGCGAGACCAAGCCCAGCACTACAACGACGAATTCCTGAGCCGGTATCGGGCC
GTCATGGAGAAGGAGTACGCGGCCAAGGTGCATGTGCAGTCTATGCGCGAGGGTCGGTTTCCCGTCCACTGGCAG
TGGAAGGAGAAGCAACGGCGCGAGTTCGAGGACAAGGTCGACGACATCAGCCATCACGTCAGTCGACGCGGCTCG
CACCATTTCAACGAGTCTGTCATTATCGAACTCGTCCGGTCGTACGCCAGTCGGGAGCTCATGCTTCCGAGCGAG
TGTAGCTGCGTGACCGAGGTGTACGAGGTCGAGAGGATACTGGACGAACAGCTGCTGTGGCCGGAGAAGAGCCTG
GCGGAGACGCTGAGCGACCAGCTGTCGTGCTCCATGTCGAGCTCTCAGGAGAGAGTCATCATCCGACTCCTGACG
ACCGGACGACTCGACGCCAACGCCCAGGACGACAACGGCAACACGGCTCTCACCCGGGCCTCGGCCCAGGGCAAC
GTCGGCGTAGTCCGAGCCGTACTCAAGTCCGGCATGGCTCGTCTCAACCTGCGCAACCACGACGGCGATACGGCC
CTCCTGCTGGCTGCCGGAGCGGGACACGCCAACATTGTCGAGATGCTGGGCAACCAGGTGTGGAAGACGGAGCGC
AGGATGGACATGAACGTGCGCAGCCGAGACGGCGGAGACACGGCCCTGACGCTGGCCGCCGAGAACATGGACGAG
GAAGTGGTCAAGAAGTTGATGCTGACCGGACACGTCCTGACCGAGCTGGTCAACCACAACAACGAGTCGGCGCTG
GACATTGCCGAGAGAAAGGGCTACCATCGGATCGCCAGGCTGATCCGCCAGCGGGCCGCCATCTACGTAGACGAC
CCGCCGCCACCGGACCTCAACGTTTTCCCCTGGACGTCGGAGCCGCCGGTGTTCTGGCCGCGGAGGGCGGTCGAG
CTGGAGCCCGGCCTCTTCGGAGGAGGAGAGGTGGCCATCTATCGGCTCAACACGGGCGAGCGGTGGCGCAACGAC
ACGGGACAGTTTTGGGATGAGGAATCGGAGGACTGGGTCTTCAAGGAAGGCGTCGCTACCCCGGATCTCTCCATG
TCGGTGCCCTCCGAGGAGGTGGAGCCGTCGGAGTCGGAATTGACAGGTGGGCCGGGGCCGAGGCCGGTGGTGGAA
CCTGCGGTGGAGCCACCGGAGACGGAGGGCCCGAAGCTCTGA
Gene >Ophio5|4909
ATGGAAAGAGGCAAGTAGAGTTATGACCTAAACGCAAACGCTTGGGGCCACGTGCCGTCATGGGACGACTGGTCT
TGGTGGGTGGTGACAAGTGCAGCCGAAGCTGATACGGACCCTACGTGAGACAGCCGGTTGGAGAAGAAGCGTTCC
ATTTCCTTCGCGGACAACAGACGACGGGTGCAAATCGCCCTGTACGCCCGTAGCGACCACTCGTTCGGTCCGGCT
CGGCACAGGGGAGGCTACGAGTCCTACCACTGGGCCATCCTCGTCAGCCCCAAGCGTCCGAGGGGAAAGGACGTC
GACGCATACGACGTGACGGACAACGTGATTGTGGACCCCGAGACTCATAAGAATCTCAACCCTTCTCGTCAATTC
TACTTGCAGATCAAGCGAGGAGTCACACCGACGTCATCGACGAAGCTGGTCGGGCGCGTCAGCCTTTGCAAGCTG
AAAGATTCTGTCACGCAAGACGATCTTGAGGCCATCATTAGACGGGTGCCAATTCCGAACAAGCTCGCCAACCCG
CCGCAGAGTTGCGTCACCTGGGCTCGCAACGCGATAGCCGAGTTACAGGATGCCGGCCTGCTTCGATCATTTGAC
TTGGACAAGTTCAGCAACTGGGCCCTCCGTTTCGCCGATAAAGGCCGGTCCAAGCTGGGTACGTCGAAGCAGTAT
GAGCACGTGGTCGAGTATGGCGAAAGGGAAGAAAAGGAGGTCATATGGGACACGGAACCGTACGACGATTACGTC
GAGTACATCTACCTGGTCACGTCGCGGACGACCGAGGAGATTCACGAGGCCAAGGGCATCTTTCCGCAAGGCTAC
TCGCCCTACCTGTCGGCTTCCGGAGAGGCCCCCGTGATCCCGGACTTGGACGTGCCGTTTGGGGGCGCCATCGAC
ATGGTGCCCAATACGGCCTATCTACGGGCGTACAAGAGGTTCGGGACGGCGGGCATGATTGCCATCAACCGGGCC
GGCTCGGAGCCGCTTCGGATATGGAAGATCAAGACGACGCAAAACATGATTCCCGAGAACAGCATCGGAGGCTTC
TGGAGCGAGGAGGAGGCCTTTCTCATCCTCGGCGGCGTTCATCTCGGTCAGATGAGAGGATACTACGAGATAGAC
GTGATGAGAGAGCGTGTCAGCGGCCGCTTCCGCGACACGCACCGGCCGCCGCATCCTTCCGACGACCCGTTCCAC
GAGAACTTGCTGTACCGGAAAGACATCTTCGCCAAAGAGCAGCACATCCGGCTCAGCGAGCTGACTCTCCGTCAC
AAGGCGAACCTGAGGGGCCTGCTACTGCTGCCGGCGTGCCGAACCCCCCCGCTTCACGGCCCCCTTGTAGTCAGG
CGGACGGCGGCGCGTTGTGCGTGGACGGACGATAGCGACGCAGGCACGGGTGGCTTGACGACATCCGTCGACGAC
GACTTGCTCCCCTCAGCTTTGCCGGATTATGATTCGATGGAAGGCCTCGACGGCGAGACGATTGTGTTTCCGGGT
CTGAGGATGCCTATGCAGGGGGAGATGGAGCCCATGGACGACGAGGAGATGACGCAGCTGGTCAACAGGCTCGCC
ATGGAGGAGACGTTGGCGCTCATGGACAGGCTAGGCTTCCATGTGGCGGTGACGGCCAAGGAAACGTTGGACGGC
ATCTTCGAATTCAGACTCCGGATGCGGCGTCACCGGGCCATCGAATCAAGTATGCAGTCCATGACGATGCCAGCC
GTGACGTCGACGCCGGCGGTCAGGACCAGGCTGTGGGGGGCGACGGCGGCCATGTCGTTGGCAGCGCTGCCGTTT
TACTTTAGGGACGTGGCCGGCATTTTCCACACCAAGATGAGGATCTGGGACCAGGTGGCGGTGGCCATGTCCATC
GTGCCCGTCATCGGCTGTGCCGCCCAGACGGTGGCGGACGCCCAGAACGGCATGGTGCCCGTGTTGCCGTCGATG
CTGTGCTTCGTAGGCGACATCCTCCTTTTCACGACGGCGTCGCTCATGGGCTTGCTGGTGCGTTCGATCGGGGCC
CTGATGGAGGAGGAGGAGAAGCACGGGGTCGACTATATCCTGCTCTCGCACGACCAGGGATGGAACGAGCATTTC
GACCAGGTCAAGGCCTACCTCGACTCGGCCGAGTGGACGGCCAAGATGACGAGTCAGTTCCTGCGCGAGACGGCC
TTGATCGTCTTCGCCGTGGCGGAGCAGAAGAGCCTGCTGGAAGCGAGCAAGTTGCTGTTGCAAAGGAACGGCGTC
TCGGACCGAGAGCGGAAACAGGCCGAGCAGGTCATGGACGCGCTGTACAACGAGACGCTGCGTACCATGTGCGTC
AAGATCAGGGAGAGGAAGCGTTGGTTTCAGATGGATCTACCGCTCGGCGTCGTCAAATGGGTGCGAGACCAAGCC
CAGCACTACAACGACGAATTCCTGAGCCGGTATCGGGCCGTCATGGAGAAGGAGTACGCGGCCAAGGTGCATGTG
CAGTCTATGCGCGAGGGTCGGTTTCCCGTCCACTGGCAGTGGAAGGAGAAGCAACGGCGCGAGTTCGAGGACAAG
GTCGACGACATCAGCCATCACGTCAGTCGACGCGGCTCGCACCATTTCAACGAGTCTGTCATTATCGAACTCGTC
CGGTCGTACGCCAGTCGGGAGCTCATGCTTCCGAGCGAGTGTAGCTGCGTGACCGAGGTGTACGAGGTCGAGAGG
ATACTGGACGAACAGCTGCTGTGGCCGGAGAAGAGCCTGGCGGAGACGCTGAGCGACCAGCTGTCGTGCTCCATG
TCGAGCTCTCAGGAGAGAGTCATCATCCGACTCCTGACGACCGGACGACTCGACGCCAACGCCCAGGACGACAAC
GGCAACACGGCTCTCACCCGGGCCTCGGCCCAGGGCAACGTCGGCGTAGTCCGAGCCGTACTCAAGTCCGGCATG
GCTCGTCTCAACCTGCGCAACCACGACGGCGATACGGCCCTCCTGCTGGCTGCCGGAGCGGGACACGCCAACATT
GTCGAGATGCTGGGCAACCAGGTGTGGAAGACGGAGCGCAGGATGGACATGAACGTGCGCAGCCGAGACGGCGGA
GACACGGCCCTGACGCTGGCCGCCGAGAACATGGACGAGGAAGTGGTCAAGAAGTTGATGCTGACCGGACACGTC
CTGACCGAGCTGGTCAACCACAACAACGAGTCGGCGCTGGACATTGCCGAGAGAAAGGGCTACCATCGGATCGCC
AGGCTGATCCGCCAGCGGGCCGCCATCTACGTAGACGACCCGCCGCCACCGGACCTCAACGTTTTCCCCTGGACG
TCGGAGCCGCCGGTGTTCTGGCCGCGGAGGGCGGTCGAGCTGGAGCCCGGCCTCTTCGGAGGAGGAGAGGTGGCC
ATCTATCGGCTCAACACGGGCGAGCGGTGGCGCAACGACACGGGACAGTTTTGGGATGAGGAATCGGAGGACTGG
GTCTTCAAGGAAGGCGTCGCTACCCCGGATCTCTCCATGTCGGTGCCCTCCGAGGAGGTGGAGCCGTCGGAGTCG
GAATTGACAGGTGGGCCGGGGCCGAGGCCGGTGGTGGAACCTGCGGTGGAGCCACCGGAGACGGAGGGCCCGAAG
CTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail