Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4901
Gene name
Locationscaffold_394:16127..17946
Strand+
Gene length (bp)1819
Transcript length (bp)1512
Coding sequence length (bp)1509
Protein length (aa) 503

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00226 DnaJ DnaJ domain 2.6E-10 130 164

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7C1|YKU3_SCHPO Uncharacterized J domain-containing protein C2E1P5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P5.03 PE=3 SV=1 100 281 6.0E-28
sp|Q96KC8|DNJC1_HUMAN DnaJ homolog subfamily C member 1 OS=Homo sapiens GN=DNAJC1 PE=1 SV=1 97 262 1.0E-09
sp|Q61712|DNJC1_MOUSE DnaJ homolog subfamily C member 1 OS=Mus musculus GN=Dnajc1 PE=1 SV=1 108 262 2.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 240 262 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4901
MSVPNLIDVYKLHTIPPWQCFSPRPPGTGRFVARGQTAPGWPLGPFRTLLSPTTTSTQKAVRGRCKYENRARFCR
AAAGPRGATGRGLEQGRRVFFPSRGTMIHSPCGNREIFRIKGEIAAHEPDPSATFYDILGVQRGASQEDINRAYR
KKSRSLHPDKVKQQLKTDRARAQAKAGGGVAPTSSEIKAAVKRASERQARLSLIANILRGPSRDRYDHFLSHGFP
LWKGTDYYYSRYRPGLGTVVFGLFLLGGGGLHYLILYMSWKRQKEFVERYVRFARETAWGSGFGSIPGIDAAMAD
GGDDDTPTPAQPMNRRQRRMQDKESRREDGSGRAKKRGRKATAASQDSPSSGPVPSGARKRVVAENGKILVVDSQ
GDVFLEGEDEEGNFNEFLLDPNELHQPTFQDTAVVRVPLWLLQVVVSRFRSKADADATDSDDAGDDSDVPQRTPS
TDSAGDDFELLDKSTDSLTKVKASGTQQGSKPHKRRNKKRTRRDLFCSVGTWT
Coding >Ophio5|4901
ATGTCAGTCCCCAACCTTATTGATGTATACAAGCTACACACAATACCCCCTTGGCAATGTTTCAGCCCCCGCCCT
CCAGGTACAGGGCGCTTCGTGGCGCGAGGACAGACAGCGCCAGGCTGGCCCCTCGGACCTTTTCGAACCCTCCTT
TCTCCCACAACGACCAGCACACAAAAGGCCGTCCGCGGACGATGCAAGTATGAGAATCGCGCACGTTTCTGTCGG
GCTGCTGCTGGCCCTCGTGGCGCCACTGGCCGCGGGCTGGAGCAAGGAAGGCGAGTCTTCTTCCCTTCCCGGGGC
ACCATGATCCATTCTCCTTGTGGCAACCGAGAAATCTTCCGCATCAAGGGCGAGATCGCGGCACACGAGCCAGAT
CCTTCGGCCACCTTCTACGACATTCTTGGTGTCCAGCGTGGCGCGTCCCAGGAAGACATCAACCGCGCCTATCGT
AAGAAGTCGCGCTCGCTGCACCCGGACAAGGTCAAGCAGCAGCTCAAGACGGATCGGGCCCGTGCTCAGGCCAAG
GCTGGCGGAGGCGTTGCCCCGACTTCTTCCGAGATCAAAGCGGCTGTCAAGCGCGCGTCGGAGCGTCAGGCGCGT
CTGTCGCTTATCGCCAATATCCTGCGTGGGCCTTCGCGCGACCGCTATGATCACTTCCTGAGCCATGGCTTCCCG
CTGTGGAAGGGCACTGACTATTACTACTCGCGCTACCGCCCAGGTCTCGGCACCGTCGTTTTTGGCCTCTTCCTT
TTGGGCGGCGGCGGCCTGCATTATTTGATCCTCTACATGAGTTGGAAGCGTCAGAAAGAGTTCGTCGAGCGCTAC
GTCCGCTTTGCTCGCGAGACTGCATGGGGCTCTGGCTTTGGCTCTATTCCCGGCATCGATGCCGCCATGGCCGAC
GGCGGTGACGACGACACTCCGACCCCGGCTCAGCCCATGAACAGGAGGCAGAGACGCATGCAGGACAAGGAGTCT
AGACGCGAAGACGGCTCCGGACGTGCCAAGAAGAGGGGTCGCAAGGCCACCGCCGCCTCGCAAGACTCACCCTCC
TCAGGTCCTGTCCCGTCTGGCGCTCGCAAGAGGGTTGTCGCCGAGAACGGCAAGATCCTCGTCGTTGACTCTCAG
GGCGATGTCTTCCTCGAGGGAGAGGATGAAGAGGGAAATTTCAACGAGTTCCTCCTCGACCCCAACGAGCTTCAT
CAACCCACCTTTCAAGACACCGCCGTCGTCCGCGTTCCCCTCTGGCTCCTCCAAGTCGTCGTCAGCCGCTTTCGC
TCCAAGGCTGATGCTGACGCGACCGACTCGGATGACGCGGGCGACGACTCGGACGTCCCGCAGCGCACGCCCAGC
ACTGACTCCGCCGGCGACGACTTCGAGCTGTTGGACAAGAGCACCGACTCACTGACCAAGGTGAAGGCGTCCGGC
ACCCAGCAGGGATCCAAGCCGCACAAGAGGAGGAACAAGAAGCGGACCAGGAGAGATTTGTTTTGCAGTGTTGGG
ACTTGGACT
Transcript >Ophio5|4901
ATGTCAGTCCCCAACCTTATTGATGTATACAAGCTACACACAATACCCCCTTGGCAATGTTTCAGCCCCCGCCCT
CCAGGTACAGGGCGCTTCGTGGCGCGAGGACAGACAGCGCCAGGCTGGCCCCTCGGACCTTTTCGAACCCTCCTT
TCTCCCACAACGACCAGCACACAAAAGGCCGTCCGCGGACGATGCAAGTATGAGAATCGCGCACGTTTCTGTCGG
GCTGCTGCTGGCCCTCGTGGCGCCACTGGCCGCGGGCTGGAGCAAGGAAGGCGAGTCTTCTTCCCTTCCCGGGGC
ACCATGATCCATTCTCCTTGTGGCAACCGAGAAATCTTCCGCATCAAGGGCGAGATCGCGGCACACGAGCCAGAT
CCTTCGGCCACCTTCTACGACATTCTTGGTGTCCAGCGTGGCGCGTCCCAGGAAGACATCAACCGCGCCTATCGT
AAGAAGTCGCGCTCGCTGCACCCGGACAAGGTCAAGCAGCAGCTCAAGACGGATCGGGCCCGTGCTCAGGCCAAG
GCTGGCGGAGGCGTTGCCCCGACTTCTTCCGAGATCAAAGCGGCTGTCAAGCGCGCGTCGGAGCGTCAGGCGCGT
CTGTCGCTTATCGCCAATATCCTGCGTGGGCCTTCGCGCGACCGCTATGATCACTTCCTGAGCCATGGCTTCCCG
CTGTGGAAGGGCACTGACTATTACTACTCGCGCTACCGCCCAGGTCTCGGCACCGTCGTTTTTGGCCTCTTCCTT
TTGGGCGGCGGCGGCCTGCATTATTTGATCCTCTACATGAGTTGGAAGCGTCAGAAAGAGTTCGTCGAGCGCTAC
GTCCGCTTTGCTCGCGAGACTGCATGGGGCTCTGGCTTTGGCTCTATTCCCGGCATCGATGCCGCCATGGCCGAC
GGCGGTGACGACGACACTCCGACCCCGGCTCAGCCCATGAACAGGAGGCAGAGACGCATGCAGGACAAGGAGTCT
AGACGCGAAGACGGCTCCGGACGTGCCAAGAAGAGGGGTCGCAAGGCCACCGCCGCCTCGCAAGACTCACCCTCC
TCAGGTCCTGTCCCGTCTGGCGCTCGCAAGAGGGTTGTCGCCGAGAACGGCAAGATCCTCGTCGTTGACTCTCAG
GGCGATGTCTTCCTCGAGGGAGAGGATGAAGAGGGAAATTTCAACGAGTTCCTCCTCGACCCCAACGAGCTTCAT
CAACCCACCTTTCAAGACACCGCCGTCGTCCGCGTTCCCCTCTGGCTCCTCCAAGTCGTCGTCAGCCGCTTTCGC
TCCAAGGCTGATGCTGACGCGACCGACTCGGATGACGCGGGCGACGACTCGGACGTCCCGCAGCGCACGCCCAGC
ACTGACTCCGCCGGCGACGACTTCGAGCTGTTGGACAAGAGCACCGACTCACTGACCAAGGTGAAGGCGTCCGGC
ACCCAGCAGGGATCCAAGCCGCACAAGAGGAGGAACAAGAAGCGGACCAGGAGAGATTTGTTTTGCAGTGTTGGG
ACTTGGACTTGA
Gene >Ophio5|4901
ATGTCAGTCCCCAACCTTATTGATGTATACAAGCTACACACAATACCCCCTTGGCAATGTTTCAGCCCCCGCCCT
CCAGGTACAGGGCGCTTCGTGGCGCGAGGACAGACAGCGCCAGGCTGGCCCCTCGGACCTTTTCGAACCCTCCTT
TCTCCCACAACGACCAGCACACAAAAGGCCGTCCGCGGACGATGCAAGTATGAGAATCGCGCACGTTTCTGTCGG
GCTGCTGCTGGCCCTCGTGGCGCCACTGGCCGCGGGCTGGAGCAAGGAAGGCGAGTCTTCTTCCCTTCCCGGGGC
ACCATGATCCATTCTCCTTGTGGCAGTCAGGCTCCGACAGAGTTCAGGATTTTCTTTCTGACCCTTCTCCCCACC
CACAGACCGAGAAATCTTCCGCATCAAGGGCGAGATCGCGGCACACGAGCCAGATCCTTCGGCCACCTTCTACGA
CATTCTTGGTGTCCAGCGTGGCGCGTCCCAGGAAGACATCAACCGCGCCTATCGTAAGAAGTCGCGCTCGCTGCA
CCCGGACAAGGTCAAGCAGCAGCTCAAGACGGATCGGGCCCGTGCTCAGGCCAAGGCTGGCGGAGGCGTTGCCCC
GACTTCTTCCGAGATCAAAGCGGCTGTCAAGCGCGCGTCGGAGCGTCAGGCGCGTCTGTCGCTTATCGCCAATAT
CCTGCGTGGGCCTTCGCGCGACCGCTATGATCACTTCCTGAGCCATGGCTTCCCGCTGTGGAAGGGCACTGACTA
TTACTACTCGCGCTACCGCCCAGGTCTCGGCACCGTCGTTTTTGGCCTCTTCCTTTTGGGCGGCGGCGGCCTGCA
TTATTTGATCCTCTACATGAGTTGGAAGCGTCAGAAAGAGTTCGTCGAGCGCTACGTCCGCTTTGCTCGCGAGAC
TGCATGGGGCTCTGGCTTTGGCTCTATTCCCGGCATCGATGCCGCCATGGCCGACGGCGGTGACGACGACACTCC
GACCCCGGCTCAGCCCATGAACAGGAGGCAGAGACGCATGCAGGACAAGGAGTCTAGACGCGAAGACGGCTCCGG
ACGTGCCAAGAAGAGGGGTCGCAAGGCCACCGCCGCCTCGCAAGACTCACCCTCCTCAGGTCCTGTCCCGTCTGG
CGCTCGCAAGAGGGTTGTCGCCGAGAACGGCAAGATCCTCGTCGTTGACTCTCAGGGCGATGTCTTCCTCGAGGG
AGAGGATGAAGAGGGAAATTTCAACGAGTTCCTCCTCGACGTGAGTCGGCCAATTTTCCTTTTTTCCGTCTCACG
TCTGCCGTCGACCATTGCTGACTTCGAATCAAAATAATATAGCCCAACGAGCTTCATCAACCCACCTTTCAAGAC
ACCGCCGTCGTCCGCGTTCCCCTCTGGCTCCTCCAAGTCGTCGTCAGCCGCTTTCGCTCCAAGGCTGATGCTGAC
GCGACCGACTCGGATGACGCGGGCGACGACTCGGACGTCCCGCAGCGCACGCCCAGCACTGACTCCGCCGGCGAC
GACTTCGAGCTGTTGGACAAGAGCACCGACTCACTGACCAAGGTGAAGGCGTCCGGCACCCAGCAGGGATCCAAG
CCGCACAAGAGGAGGAACAAGAAGCGTTAGACAATCTCTCTTATCTACTCGGCTCGGGCCGTTGACACCCCTTGT
GTACTCGGAAAGGATAGACGGTACTCTACGGAAGATGGACAGGCAGAGTCGATGAATAGATGTTTCTTAGGGACC
AGGTAGGCAGACTTTGAAGCGGAGCTTTCACGCATCGCTAAGCGGAGGAGAATGTAGGAGAGATTTGTTTTGCAG
TGTTGGGACTTGGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail