Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4892
Gene name
Locationscaffold_393:8804..12809
Strand-
Gene length (bp)4005
Transcript length (bp)3390
Coding sequence length (bp)3387
Protein length (aa) 1129

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05193 Peptidase_M16_C Peptidase M16 inactive domain 1.9E-13 274 452
PF00675 Peptidase_M16 Insulinase (Peptidase family M16) 4.7E-07 136 220

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10068|YAN2_SCHPO Uncharacterized protein C3H1.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.02c PE=4 SV=1 84 1104 7.0E-169
sp|Q12496|YO098_YEAST Uncharacterized protein YOL098C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL098C PE=1 SV=1 86 1083 8.0E-167
sp|P48053|YPD1_CAEEL Uncharacterized protein C05D11.1 OS=Caenorhabditis elegans GN=C05D11.1 PE=4 SV=2 104 1041 1.0E-109
sp|Q9LJL3|PREP1_ARATH Presequence protease 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=PREP1 PE=1 SV=2 135 965 6.0E-30
sp|Q8VY06|PREP2_ARATH Presequence protease 2, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=PREP2 PE=1 SV=1 92 965 3.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10068|YAN2_SCHPO Uncharacterized protein C3H1.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.02c PE=4 SV=1 84 1104 7.0E-169
sp|Q12496|YO098_YEAST Uncharacterized protein YOL098C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL098C PE=1 SV=1 86 1083 8.0E-167
sp|P48053|YPD1_CAEEL Uncharacterized protein C05D11.1 OS=Caenorhabditis elegans GN=C05D11.1 PE=4 SV=2 104 1041 1.0E-109
sp|Q9LJL3|PREP1_ARATH Presequence protease 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=PREP1 PE=1 SV=2 135 965 6.0E-30
sp|Q8VY06|PREP2_ARATH Presequence protease 2, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=PREP2 PE=1 SV=1 92 965 3.0E-23
sp|Q4IA56|CYM1_GIBZE Mitochondrial presequence protease OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYM1 PE=3 SV=1 124 1050 5.0E-21
sp|Q5JRX3|PREP_HUMAN Presequence protease, mitochondrial OS=Homo sapiens GN=PITRM1 PE=1 SV=3 124 669 1.0E-19
sp|Q5RDG3|PREP_PONAB Presequence protease, mitochondrial OS=Pongo abelii GN=PITRM1 PE=2 SV=1 124 669 4.0E-19
sp|Q46205|HYPA_CLOPE Protein HypA OS=Clostridium perfringens (strain 13 / Type A) GN=hypA PE=4 SV=2 135 592 5.0E-18
sp|Q28BR5|PREP_XENTR Presequence protease, mitochondrial OS=Xenopus tropicalis GN=pitrm1 PE=2 SV=1 124 399 1.0E-16
sp|Q7ZVZ6|PREP_DANRE Presequence protease, mitochondrial OS=Danio rerio GN=pitrm1 PE=2 SV=1 124 331 3.0E-16
sp|Q7S7C0|CYM1_NEUCR Mitochondrial presequence protease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cym-1 PE=3 SV=1 124 314 6.0E-16
sp|Q6PF24|PREP_XENLA Presequence protease, mitochondrial OS=Xenopus laevis GN=pitrm1 PE=2 SV=1 124 399 5.0E-15
sp|Q8K411|PREP_MOUSE Presequence protease, mitochondrial OS=Mus musculus GN=Pitrm1 PE=1 SV=1 124 702 5.0E-15
sp|Q5A301|CYM1_CANAL Mitochondrial presequence protease OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CYM1 PE=3 SV=1 124 344 2.0E-14
sp|Q6BTC0|CYM1_DEBHA Mitochondrial presequence protease OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CYM1 PE=3 SV=2 124 316 6.0E-14
sp|O42908|CYM1_SCHPO Mitochondrial presequence protease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cym1 PE=3 SV=1 86 311 9.0E-14
sp|Q759T9|CYM1_ASHGO Mitochondrial presequence protease OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CYM1 PE=3 SV=2 135 399 5.0E-13
sp|Q2UGN1|CYM1_ASPOR Mitochondrial presequence protease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cym1 PE=3 SV=1 135 299 6.0E-13
sp|Q5B6H7|CYM1_EMENI Mitochondrial presequence protease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cym1 PE=3 SV=1 135 330 1.0E-12
sp|Q9V9E3|PREP_DROME Presequence protease, mitochondrial OS=Drosophila melanogaster GN=CG3107 PE=2 SV=2 107 335 3.0E-12
sp|Q4WP38|CYM1_ASPFU Mitochondrial presequence protease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cym1 PE=3 SV=1 135 399 4.0E-12
sp|Q6CWW6|CYM1_KLULA Mitochondrial presequence protease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CYM1 PE=3 SV=1 124 311 7.0E-12
sp|P31828|PQQL_ECOLI Probable zinc protease PqqL OS=Escherichia coli (strain K12) GN=pqqL PE=3 SV=2 109 331 3.0E-11
sp|Q6C0U8|CYM1_YARLI Mitochondrial presequence protease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CYM1 PE=3 SV=1 124 317 3.0E-11
sp|O51246|Y228_BORBU Uncharacterized protein BB_0228 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=BB_0228 PE=4 SV=1 104 312 7.0E-11
sp|P32898|CYM1_YEAST Mitochondrial presequence protease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYM1 PE=1 SV=2 124 311 1.0E-08
sp|Q6FUI7|CYM1_CANGA Mitochondrial presequence protease OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CYM1 PE=3 SV=1 124 960 1.0E-08
sp|P55679|Y4WA_RHISN Uncharacterized zinc protease y4wA OS=Rhizobium sp. (strain NGR234) GN=NGR_a01040 PE=3 SV=1 109 435 2.0E-08
sp|O86835|Y5738_STRCO Uncharacterized zinc protease SCO5738 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5738 PE=3 SV=1 137 410 4.0E-08
sp|P45181|PQQL_HAEIN Probable zinc protease PqqL OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pqqL PE=3 SV=1 109 382 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4892
MTLRLAAAGTGTCLWHAGLLSSSRSGLLSVLRYHLGLLQTPDLTLLLSLCQSPLRSFHWLEARSPFIHRLYAPPS
RMPSDALKSRFRKIQSFKTDYAPCIITQYVSDRSGMSVVVADRKGPKINGYFTLATEVLDDSGAPHTLEHLIFMG
SKTYRYKGLLDKLSSRAYSSTNAWTATDHTAYTLETAGWDGFSQVLPVYLEHIILPVITDEAIVTEVWHIDGEGN
DAGVVYSEMQAVQFRSSEIMDLKARRLLYPEDVGFRYETGGMTDALRVLTPERIRQFHRDMYQPRNLCLVIVGEA
DHDDLLRILDEFEESIEDDIPSLSAPFKRPWIDSSQPPALRETVVTTAEFPEEDESVGEILIGFFGPNCIDMVAT
SALNVLLTYLCGSSVSILENVLVEREELASSISHYWESRPNSVIWLQPTGVATGKLELVEKRLLELLKEVASKPI
DMDYMRDCIRREKRQVKFHAETSESFYATNIITDYLFGKRDGSTLREIETLGEYEDLERWTDEEWRQFLSKWMAD
AHHVSILGKPSLALAAKMKSEEAERIAKRKEELGPEGLQELGKRLEEAKQKNDVPIPAEVLERWSIPGTESIHFI
ESDTARSGQARSVGLGHGAAQARIDAAGDGDWPLFIQFEDVPTSFVHITIHVGTSQVPVELKPLMHIFSDNFFNT
HIMRDGKLVNFEQVVREIERDSVGYGIGSARSLGDPDGLMIQFQVEPDKYAVAVNWLRTMMFDSVFDAPRLRAAV
IKALADVPEGKRDGRGMASEVDAAIHMDKSSLSVAKRVLVRAVYLKRLRKLLRDDPDKVLSWFETLRSSLLTAQN
MRFLVTAKLEGLEEPVSTWDRLAEVLPREKGEQGMVPIPKLVSLLNDEGRQPGSYGAVVIPMTTLDSSYSVSSAR
SITSLSDPRFPAIMVAIGYLESVEGPLWNAVRGAGYAYGSYFSRNVDSGILSYRVYRSPDASKAMAASRDAIRAI
AEGEVAIDRHLLEGTMSQIVVMFADEQATMPSAAQQNFVQGVVRGLPKDWNKDILKRVRAVTEDEMKAVMRDLIL
PCFQPGTSNVVVTCAKLMSEGIESALKGVGYKVQTRELSYFHDDYGLEAGEDEDEDEDEDVDEDEGGSYSGSEDE
DEDD
Coding >Ophio5|4892
ATGACCTTGAGACTCGCAGCTGCCGGCACCGGAACTTGTCTCTGGCACGCCGGTCTGCTCTCCTCGTCGCGCTCT
GGGCTCCTTTCCGTGTTGCGGTACCATCTAGGTCTGTTACAGACTCCAGACCTCACTCTACTCTTGTCCCTTTGT
CAATCACCTCTGCGTTCTTTTCACTGGCTTGAAGCGAGGTCCCCGTTCATCCATCGACTCTACGCCCCACCGTCA
AGGATGCCTTCGGACGCGCTCAAGTCCCGGTTCCGCAAGATCCAGAGCTTCAAGACCGACTATGCCCCTTGCATC
ATCACGCAGTATGTATCGGATCGCAGCGGCATGTCCGTCGTCGTAGCCGACCGAAAGGGCCCTAAGATAAACGGC
TACTTTACTCTCGCCACCGAGGTCCTCGACGACTCGGGAGCGCCACACACGCTGGAACATCTCATTTTTATGGGC
TCTAAGACTTACCGGTACAAGGGCCTGCTCGACAAGCTCTCTTCGCGCGCCTACTCGTCGACCAATGCCTGGACG
GCCACGGATCATACCGCCTACACACTCGAGACTGCTGGCTGGGACGGCTTCTCCCAGGTGCTTCCCGTTTACCTA
GAGCACATTATCCTGCCCGTCATCACCGACGAAGCCATCGTCACCGAGGTCTGGCACATCGATGGAGAGGGCAAT
GACGCCGGCGTCGTCTACTCCGAGATGCAGGCTGTGCAGTTCCGTAGCTCGGAGATTATGGACCTCAAGGCCCGT
CGGCTTCTGTATCCAGAAGACGTCGGCTTTCGCTACGAAACCGGCGGCATGACCGACGCCTTACGGGTCCTTACT
CCTGAGCGTATTCGACAATTTCATCGCGACATGTACCAGCCTCGCAACCTCTGCCTCGTCATCGTCGGAGAGGCC
GATCACGATGACCTGCTGCGTATCCTGGACGAGTTTGAGGAGAGCATTGAGGACGATATTCCGTCCCTAAGTGCC
CCTTTCAAGCGTCCATGGATCGATTCTTCTCAGCCCCCTGCGCTTCGAGAGACCGTTGTTACCACGGCAGAGTTT
CCCGAGGAGGATGAATCCGTCGGTGAAATCCTCATCGGCTTCTTCGGGCCCAACTGCATCGACATGGTGGCCACG
TCAGCGCTCAATGTCCTGCTTACCTACCTCTGCGGCTCGTCTGTCTCCATCCTCGAAAACGTCCTCGTTGAGCGA
GAGGAGCTGGCTAGTTCCATTTCCCACTACTGGGAGTCTCGGCCCAATTCCGTCATCTGGCTACAGCCAACCGGA
GTCGCCACCGGGAAGCTAGAGTTGGTCGAGAAGCGGCTGTTGGAACTGCTCAAGGAGGTGGCGTCGAAGCCGATC
GACATGGACTACATGCGCGACTGCATTCGTCGGGAGAAACGCCAGGTCAAATTTCACGCAGAAACGTCTGAGTCT
TTCTACGCCACCAACATCATCACCGACTACCTTTTCGGGAAACGCGACGGCTCCACTCTCCGGGAGATCGAGACG
CTGGGAGAATATGAAGATCTGGAGCGATGGACAGACGAGGAATGGCGTCAGTTCCTAAGCAAGTGGATGGCCGAC
GCCCATCACGTCTCTATCCTCGGGAAGCCGTCGCTCGCTCTCGCGGCCAAGATGAAGAGCGAAGAGGCTGAGCGT
ATCGCAAAGCGCAAGGAGGAGCTCGGTCCCGAGGGCCTGCAGGAGCTGGGGAAGCGGCTGGAAGAGGCCAAGCAG
AAAAACGACGTGCCGATCCCGGCCGAGGTGCTCGAGCGCTGGTCCATCCCCGGCACTGAGTCGATCCACTTCATA
GAGTCGGATACGGCGCGGTCCGGCCAGGCTCGGTCCGTCGGGCTCGGCCACGGGGCGGCGCAGGCTCGGATCGAC
GCCGCTGGGGACGGCGACTGGCCGCTCTTTATTCAGTTCGAGGACGTGCCGACTAGCTTTGTGCATATCACGATT
CACGTCGGCACGTCGCAGGTGCCCGTTGAGCTGAAGCCGCTGATGCACATCTTCAGCGACAACTTCTTCAACACG
CACATCATGCGCGACGGGAAGCTCGTCAACTTTGAGCAGGTAGTACGGGAGATTGAGCGCGACAGTGTCGGATAC
GGCATCGGCTCGGCACGCTCTCTCGGCGATCCAGACGGGCTCATGATTCAGTTCCAGGTTGAGCCGGACAAGTAT
GCCGTCGCCGTCAACTGGCTGCGGACCATGATGTTCGACTCGGTATTTGACGCGCCGAGGTTGCGCGCTGCCGTC
ATCAAGGCGCTCGCGGACGTGCCCGAGGGCAAACGCGACGGTCGCGGCATGGCCAGCGAGGTGGACGCGGCCATT
CACATGGACAAGTCGTCCCTGTCCGTGGCCAAGCGCGTTCTTGTCAGGGCCGTCTACCTCAAGCGCCTCAGGAAA
CTCCTTCGCGACGATCCGGACAAGGTGCTTTCGTGGTTCGAAACGCTGCGGAGCTCTCTCCTGACGGCGCAGAAC
ATGCGCTTCTTGGTGACGGCGAAGCTCGAGGGCCTCGAGGAACCGGTCTCGACCTGGGATCGACTCGCCGAGGTG
CTGCCCCGAGAGAAAGGGGAACAAGGTATGGTGCCTATCCCCAAGCTGGTGAGCCTCCTCAACGACGAGGGGCGC
CAGCCGGGCTCGTATGGCGCCGTCGTCATCCCCATGACGACGCTCGACAGCTCTTACTCGGTCAGCTCGGCGCGC
AGCATCACGTCGCTTTCGGACCCGCGCTTCCCGGCCATCATGGTGGCCATCGGATATCTCGAGTCGGTCGAAGGG
CCGCTGTGGAACGCCGTCAGGGGTGCCGGCTACGCGTACGGCTCATATTTCTCTCGCAACGTCGACTCTGGCATT
CTCTCGTACCGCGTCTACCGCTCGCCGGACGCGTCCAAGGCCATGGCGGCTTCGCGCGACGCCATCCGTGCCATT
GCCGAGGGCGAAGTCGCCATCGATCGCCATCTTCTGGAGGGGACCATGAGCCAGATCGTAGTCATGTTTGCTGAT
GAGCAGGCTACCATGCCGAGCGCCGCGCAGCAGAATTTTGTCCAGGGCGTCGTCAGGGGTCTGCCCAAGGATTGG
AACAAGGATATCCTCAAGCGTGTGAGGGCCGTGACCGAGGACGAGATGAAGGCCGTCATGAGGGATCTGATTCTG
CCTTGTTTCCAGCCGGGGACGAGCAACGTTGTGGTGACGTGTGCGAAGCTCATGTCCGAGGGTATCGAGTCAGCA
TTAAAGGGCGTGGGGTACAAGGTTCAGACGCGCGAGCTGAGCTACTTCCACGACGACTACGGTCTCGAAGCCGGC
GAAGACGAAGACGAAGACGAGGACGAGGACGTGGATGAAGACGAGGGGGGTTCCTACAGCGGTAGCGAGGATGAG
GATGAGGACGAC
Transcript >Ophio5|4892
ATGACCTTGAGACTCGCAGCTGCCGGCACCGGAACTTGTCTCTGGCACGCCGGTCTGCTCTCCTCGTCGCGCTCT
GGGCTCCTTTCCGTGTTGCGGTACCATCTAGGTCTGTTACAGACTCCAGACCTCACTCTACTCTTGTCCCTTTGT
CAATCACCTCTGCGTTCTTTTCACTGGCTTGAAGCGAGGTCCCCGTTCATCCATCGACTCTACGCCCCACCGTCA
AGGATGCCTTCGGACGCGCTCAAGTCCCGGTTCCGCAAGATCCAGAGCTTCAAGACCGACTATGCCCCTTGCATC
ATCACGCAGTATGTATCGGATCGCAGCGGCATGTCCGTCGTCGTAGCCGACCGAAAGGGCCCTAAGATAAACGGC
TACTTTACTCTCGCCACCGAGGTCCTCGACGACTCGGGAGCGCCACACACGCTGGAACATCTCATTTTTATGGGC
TCTAAGACTTACCGGTACAAGGGCCTGCTCGACAAGCTCTCTTCGCGCGCCTACTCGTCGACCAATGCCTGGACG
GCCACGGATCATACCGCCTACACACTCGAGACTGCTGGCTGGGACGGCTTCTCCCAGGTGCTTCCCGTTTACCTA
GAGCACATTATCCTGCCCGTCATCACCGACGAAGCCATCGTCACCGAGGTCTGGCACATCGATGGAGAGGGCAAT
GACGCCGGCGTCGTCTACTCCGAGATGCAGGCTGTGCAGTTCCGTAGCTCGGAGATTATGGACCTCAAGGCCCGT
CGGCTTCTGTATCCAGAAGACGTCGGCTTTCGCTACGAAACCGGCGGCATGACCGACGCCTTACGGGTCCTTACT
CCTGAGCGTATTCGACAATTTCATCGCGACATGTACCAGCCTCGCAACCTCTGCCTCGTCATCGTCGGAGAGGCC
GATCACGATGACCTGCTGCGTATCCTGGACGAGTTTGAGGAGAGCATTGAGGACGATATTCCGTCCCTAAGTGCC
CCTTTCAAGCGTCCATGGATCGATTCTTCTCAGCCCCCTGCGCTTCGAGAGACCGTTGTTACCACGGCAGAGTTT
CCCGAGGAGGATGAATCCGTCGGTGAAATCCTCATCGGCTTCTTCGGGCCCAACTGCATCGACATGGTGGCCACG
TCAGCGCTCAATGTCCTGCTTACCTACCTCTGCGGCTCGTCTGTCTCCATCCTCGAAAACGTCCTCGTTGAGCGA
GAGGAGCTGGCTAGTTCCATTTCCCACTACTGGGAGTCTCGGCCCAATTCCGTCATCTGGCTACAGCCAACCGGA
GTCGCCACCGGGAAGCTAGAGTTGGTCGAGAAGCGGCTGTTGGAACTGCTCAAGGAGGTGGCGTCGAAGCCGATC
GACATGGACTACATGCGCGACTGCATTCGTCGGGAGAAACGCCAGGTCAAATTTCACGCAGAAACGTCTGAGTCT
TTCTACGCCACCAACATCATCACCGACTACCTTTTCGGGAAACGCGACGGCTCCACTCTCCGGGAGATCGAGACG
CTGGGAGAATATGAAGATCTGGAGCGATGGACAGACGAGGAATGGCGTCAGTTCCTAAGCAAGTGGATGGCCGAC
GCCCATCACGTCTCTATCCTCGGGAAGCCGTCGCTCGCTCTCGCGGCCAAGATGAAGAGCGAAGAGGCTGAGCGT
ATCGCAAAGCGCAAGGAGGAGCTCGGTCCCGAGGGCCTGCAGGAGCTGGGGAAGCGGCTGGAAGAGGCCAAGCAG
AAAAACGACGTGCCGATCCCGGCCGAGGTGCTCGAGCGCTGGTCCATCCCCGGCACTGAGTCGATCCACTTCATA
GAGTCGGATACGGCGCGGTCCGGCCAGGCTCGGTCCGTCGGGCTCGGCCACGGGGCGGCGCAGGCTCGGATCGAC
GCCGCTGGGGACGGCGACTGGCCGCTCTTTATTCAGTTCGAGGACGTGCCGACTAGCTTTGTGCATATCACGATT
CACGTCGGCACGTCGCAGGTGCCCGTTGAGCTGAAGCCGCTGATGCACATCTTCAGCGACAACTTCTTCAACACG
CACATCATGCGCGACGGGAAGCTCGTCAACTTTGAGCAGGTAGTACGGGAGATTGAGCGCGACAGTGTCGGATAC
GGCATCGGCTCGGCACGCTCTCTCGGCGATCCAGACGGGCTCATGATTCAGTTCCAGGTTGAGCCGGACAAGTAT
GCCGTCGCCGTCAACTGGCTGCGGACCATGATGTTCGACTCGGTATTTGACGCGCCGAGGTTGCGCGCTGCCGTC
ATCAAGGCGCTCGCGGACGTGCCCGAGGGCAAACGCGACGGTCGCGGCATGGCCAGCGAGGTGGACGCGGCCATT
CACATGGACAAGTCGTCCCTGTCCGTGGCCAAGCGCGTTCTTGTCAGGGCCGTCTACCTCAAGCGCCTCAGGAAA
CTCCTTCGCGACGATCCGGACAAGGTGCTTTCGTGGTTCGAAACGCTGCGGAGCTCTCTCCTGACGGCGCAGAAC
ATGCGCTTCTTGGTGACGGCGAAGCTCGAGGGCCTCGAGGAACCGGTCTCGACCTGGGATCGACTCGCCGAGGTG
CTGCCCCGAGAGAAAGGGGAACAAGGTATGGTGCCTATCCCCAAGCTGGTGAGCCTCCTCAACGACGAGGGGCGC
CAGCCGGGCTCGTATGGCGCCGTCGTCATCCCCATGACGACGCTCGACAGCTCTTACTCGGTCAGCTCGGCGCGC
AGCATCACGTCGCTTTCGGACCCGCGCTTCCCGGCCATCATGGTGGCCATCGGATATCTCGAGTCGGTCGAAGGG
CCGCTGTGGAACGCCGTCAGGGGTGCCGGCTACGCGTACGGCTCATATTTCTCTCGCAACGTCGACTCTGGCATT
CTCTCGTACCGCGTCTACCGCTCGCCGGACGCGTCCAAGGCCATGGCGGCTTCGCGCGACGCCATCCGTGCCATT
GCCGAGGGCGAAGTCGCCATCGATCGCCATCTTCTGGAGGGGACCATGAGCCAGATCGTAGTCATGTTTGCTGAT
GAGCAGGCTACCATGCCGAGCGCCGCGCAGCAGAATTTTGTCCAGGGCGTCGTCAGGGGTCTGCCCAAGGATTGG
AACAAGGATATCCTCAAGCGTGTGAGGGCCGTGACCGAGGACGAGATGAAGGCCGTCATGAGGGATCTGATTCTG
CCTTGTTTCCAGCCGGGGACGAGCAACGTTGTGGTGACGTGTGCGAAGCTCATGTCCGAGGGTATCGAGTCAGCA
TTAAAGGGCGTGGGGTACAAGGTTCAGACGCGCGAGCTGAGCTACTTCCACGACGACTACGGTCTCGAAGCCGGC
GAAGACGAAGACGAAGACGAGGACGAGGACGTGGATGAAGACGAGGGGGGTTCCTACAGCGGTAGCGAGGATGAG
GATGAGGACGACTGA
Gene >Ophio5|4892
ATGACCTTGAGAGTAAACAGACATATCTTATCGTTGGCCTGCAATCGATAGCAGCCCCCTCCTCTAAAAACCCAC
CGGCGGCGCCAAATAAATCATCGCAACCAACTTCAGTTGGGCCACTCCAGCTTTTCTTCCTCTTCGTCGCCAACC
GTCTCGCAAAGACGCCTTCCTTAGTTCTAGCTCGCAGCTGCCGGCACCGGAACTTGTCTCTGGCACGCCGGTCTG
CTCTCCTCGTCGCGCTCTGGGCTCCTTTCCGTGTTGCGGTACCATCTAGGTCTGTTACAGACTCCAGACCTCACT
CTACTCTTGTCCCTTTGTCAATCACCTCTGCGTTCTTTTCACTGGCTTGAAGCGAGGTCCCCGTGTGCGTCTTCT
GTCCCCTCCCCCTTGACTTGCCATCGCCAATCGTCATACAAACCTGTCTGTCAGTCATCCATCGACTCTAGTACG
TCCTCCACGCCGCGGCCTAAGCCACGGATGCTGCACATGCATTCAGTCTTCGTATTTCCAACGTCATCAGGGTGG
TTTGCGCCCTTGGAGCTCTTCGCATCTCTTTCAGCCATTCTACAAGGCTTTGTCCGCAGCCTGTCTTGTTCAATG
AGCCCATGAGCTATCATACTAAATAACGCGATCTTCTGGCTGACGCACTACTTCCAGCGCCCCACCGTCAAGGAT
GCCTTCGGACGCGCTCAAGTCCCGGTTCCGCAAGATCCAGAGCTTCAAGACCGACTATGCCCCTTGCATCATCAC
GCAGTATGTATCGGATCGCAGCGGCATGTCCGTCGTCGTAGCCGACCGAAAGGGCCCTAAGATAAACGGCTACTT
TACTCTCGCCACCGAGGTCCTCGACGACTCGGGAGCGCCACACACGCTGGAACATCTCATTTTTATGGGCTCTAA
GACTTACCGGTACAAGGGCCTGCTCGACAAGCTCTCTTCGCGCGCCTACTCGTCGACCAATGCCTGGACGGCCAC
GGATCATACCGCCTACACACTCGAGACTGCTGGCTGGGACGGCTTCTCCCAGGTGCTTCCCGTTTACCTAGAGCA
CATTATCCTGCCCGTCATCACCGACGAAGCCATCGTCACCGAGGTCTGGCACATCGATGGAGAGGGCAATGACGC
CGGCGTCGTCTACTCCGAGATGCAGGCTGTGCAGTTCCGTAGCTCGGAGATTATGGACCTCAAGGCCCGTCGGCT
TCTGTATCCAGAAGACGTCGGCTTTCGCTACGAAACCGGCGGCATGACCGACGCCTTACGGGTCCTTACTCCTGA
GCGTATTCGACAATTTCATCGCGACATGTACCAGCCTCGCAACCTCTGCCTCGTCATCGTCGGAGAGGCCGATCA
CGATGACCTGCTGCGTATCCTGGACGAGTTTGAGGAGAGCATTGAGGACGATATTCCGTCCCTAAGTGCCCCTTT
CAAGCGGTAAGTCCCTTTCGTTGCCTCTGTTGAGTGCCCATCTTATGACACACAACACTCAGTCCATGGATCGAT
TCTTCTCAGCCCCCTGCGCTTCGAGAGACCGTTGTTACCACGGCAGAGTTTCCCGAGGAGGATGAATCCGTCGGT
GAAATCCTCATCGGCTTCTTCGGGCCCAACTGCATCGACATGGTGGCCACGTCAGCGCTCAATGTCCTGCTTACC
TACCTCTGCGGCTCGTCTGTCTCCATCCTCGAAAACGTCCTCGTTGAGCGAGAGGAGCTGGCTAGTTCCATTTCC
CACTACTGGGAGTCTCGGCCCAATTCCGTCATCTGGCTACAGCCAACCGGAGTCGCCACCGGGAAGCTAGAGTTG
GTCGAGAAGCGGCTGTTGGAACTGCTCAAGGAGGTGGCGTCGAAGCCGATCGACATGGACTACATGCGCGACTGC
ATTCGTCGGGAGAAACGCCAGGTCAAATTTCACGCAGAAACGTCTGAGTCTTTCTACGCCACCAACATCATCACC
GACTACCTTTTCGGGAAACGCGACGGCTCCACTCTCCGGGAGATCGAGACGCTGGGAGAATATGAAGATCTGGAG
CGATGGACAGACGAGGAATGGCGTCAGTTCCTAAGCAAGTGGATGGCCGACGCCCATCACGTCTCTATCCTCGGG
AAGCCGTCGCTCGCTCTCGCGGCCAAGATGAAGAGCGAAGAGGCTGAGCGTATCGCAAAGCGCAAGGAGGAGCTC
GGTCCCGAGGGCCTGCAGGAGCTGGGGAAGCGGCTGGAAGAGGCCAAGCAGAAAAACGACGTGCCGATCCCGGCC
GAGGTGCTCGAGCGCTGGTCCATCCCCGGCACTGAGTCGATCCACTTCATAGAGTCGGATACGGCGCGGTCCGGC
CAGGCTCGGTCCGTCGGGCTCGGCCACGGGGCGGCGCAGGCTCGGATCGACGCCGCTGGGGACGGCGACTGGCCG
CTCTTTATTCAGTTCGAGGACGTGCCGACTAGCTTTGTGCATATCACGATTCACGTCGGCACGTCGCAGGTGCCC
GTTGAGCTGAAGCCGCTGATGCACATCTTCAGCGACAACTTCTTCAACACGCACATCATGCGCGACGGGAAGCTC
GTCAACTTTGAGCAGGTAGTACGGGAGATTGAGCGCGACAGTGTCGGATACGGCATCGGCTCGGCACGCTCTCTC
GGCGATCCAGACGGGCTCATGATTCAGTTCCAGGTTGAGCCGGACAAGTATGCCGTCGCCGTCAACTGGCTGCGG
ACCATGATGTTCGACTCGGTATTTGACGCGCCGAGGTTGCGCGCTGCCGTCATCAAGGCGCTCGCGGACGTGCCC
GAGGGCAAACGCGACGGTCGCGGCATGGCCAGCGAGGTGGACGCGGCCATTCACATGGACAAGTCGTCCCTGTCC
GTGGCCAAGCGCGTTCTTGTCAGGGCCGTCTACCTCAAGCGCCTCAGGAAACTCCTTCGCGACGATCCGGACAAG
GTGCTTTCGTGGTTCGAAACGCTGCGGAGCTCTCTCCTGACGGCGCAGAACATGCGCTTCTTGGTGACGGCGAAG
CTCGAGGGCCTCGAGGAACCGGTCTCGACCTGGGATCGACTCGCCGAGGTGCTGCCCCGAGAGAAAGGGGAACAA
GGTATGGTGCCTATCCCCAAGCTGGTGAGCCTCCTCAACGACGAGGGGCGCCAGCCGGGCTCGTATGGCGCCGTC
GTCATCCCCATGACGACGCTCGACAGCTCTTACTCGGTCAGCTCGGCGCGCAGCATCACGTCGCTTTCGGACCCG
CGCTTCCCGGCCATCATGGTGGCCATCGGATATCTCGAGTCGGTCGAAGGGCCGCTGTGGAACGCCGTCAGGGGT
GCCGGCTACGCGTACGGCTCATATTTCTCTCGCAACGTCGACTCTGGCATTCTCTCGTACCGCGTCTACCGCTCG
CCGGACGCGTCCAAGGCCATGGCGGCTTCGCGCGACGCCATCCGTGCCATTGCCGAGGGCGAAGTCGCCATCGAT
CGCCATCTTCTGGAGGGGACCATGAGCCAGATCGTAGTCATGTTTGCTGATGAGCAGGCTACCATGCCGAGCGCC
GCGCAGCAGAATTTTGTCCAGGGCGTCGTCAGGGGTCTGCCCAAGGATTGGAACAAGGATATCCTCAAGCGTGTG
AGGGCCGTGACCGAGGACGAGATGAAGGCCGTCATGAGGGATCTGATTCTGCCTTGTTTCCAGCCGGGGACGAGC
AACGTTGTGGTGACGTGTGCGAAGCTCATGTCCGAGGTCAGCACTCACTCACTCAACTTTCCCCCCTCTTTTTTT
TCTTTTCGTCAATTTTCTTCTTCTCCCTTTCCCCTTCCTCCCCTTTCCCCCCCTCGGCTGACCCAATAGTTTCAG
GGTATCGAGTCAGCATTAAAGGGCGTGGGGTACAAGGTTCAGACGCGCGAGCTGAGCTACTTCCACGACGACTAC
GGTCTCGAAGCCGGCGAAGACGAAGACGAAGACGAGGACGAGGACGTGGATGAAGACGAGGGGGGTTCCTACAGC
GGTAGCGAGGATGAGGATGAGGACGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail