Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4891
Gene name
Locationscaffold_393:6861..8502
Strand+
Gene length (bp)1641
Transcript length (bp)1425
Coding sequence length (bp)1422
Protein length (aa) 474

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16491 Peptidase_M48_N CAAX prenyl protease N-terminal, five membrane helices 5.1E-61 40 224
PF01435 Peptidase_M48 Peptidase family M48 5.3E-46 227 431

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P47154|STE24_YEAST CAAX prenyl protease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE24 PE=1 SV=1 7 434 2.0E-127
sp|Q10071|STE24_SCHPO Probable CAAX prenyl protease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.05 PE=3 SV=1 1 434 1.0E-113
sp|Q8RX88|FACE1_ARATH CAAX prenyl protease 1 homolog OS=Arabidopsis thaliana GN=FACE1 PE=1 SV=1 17 431 6.0E-112
sp|Q6EPN8|FACE1_ORYSJ CAAX prenyl protease 1 homolog OS=Oryza sativa subsp. japonica GN=FACE1 PE=2 SV=1 17 435 4.0E-105
sp|Q80W54|FACE1_MOUSE CAAX prenyl protease 1 homolog OS=Mus musculus GN=Zmpste24 PE=1 SV=2 16 430 2.0E-95
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P47154|STE24_YEAST CAAX prenyl protease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE24 PE=1 SV=1 7 434 2.0E-127
sp|Q10071|STE24_SCHPO Probable CAAX prenyl protease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.05 PE=3 SV=1 1 434 1.0E-113
sp|Q8RX88|FACE1_ARATH CAAX prenyl protease 1 homolog OS=Arabidopsis thaliana GN=FACE1 PE=1 SV=1 17 431 6.0E-112
sp|Q6EPN8|FACE1_ORYSJ CAAX prenyl protease 1 homolog OS=Oryza sativa subsp. japonica GN=FACE1 PE=2 SV=1 17 435 4.0E-105
sp|Q80W54|FACE1_MOUSE CAAX prenyl protease 1 homolog OS=Mus musculus GN=Zmpste24 PE=1 SV=2 16 430 2.0E-95
sp|O75844|FACE1_HUMAN CAAX prenyl protease 1 homolog OS=Homo sapiens GN=ZMPSTE24 PE=1 SV=2 17 430 1.0E-92
sp|Q54FH7|FACE1_DICDI CAAX prenyl protease 1 homolog OS=Dictyostelium discoideum GN=zmpste24 PE=3 SV=1 23 444 2.0E-85
sp|Q9XVE5|FACE1_CAEEL CAAX prenyl protease 1 homolog OS=Caenorhabditis elegans GN=fce-1 PE=1 SV=1 20 430 2.0E-71
sp|P40769|YHFN_BACSU Uncharacterized metalloprotease YhfN OS=Bacillus subtilis (strain 168) GN=yhfN PE=3 SV=2 121 444 2.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0043170 macromolecule metabolic process No
GO:0016787 hydrolase activity No
GO:0019538 protein metabolic process No
GO:0008237 metallopeptidase activity No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0008233 peptidase activity No
GO:0008150 biological_process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0004175 endopeptidase activity No
GO:0140096 catalytic activity, acting on a protein No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 95 117 22
2 124 146 22
3 166 188 22
4 195 217 22
5 312 334 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4891
MDFLQRLARFLDRPLFPWKKLILGFSIGQYVFESFLTLRQYRVLLQRKPPAVLSKEVSQETFDKSQAYGRAKARF
ELINGLWGQLQNVAFVQMDVLPALWAWCGGLVASYAPAWFAGEIGHSIVFVYVFILLQQVLGLPGRVYHTFVLEE
AFGFNKQTPKLFLADMVKTNLLTAAIMPPILAAFLAIIRRTGSQFVFYLWAFSAALQLFTTTAYPMFIQPIFNKL
SPLDEGELKTRVEGLAATQKFPLQDLFVIDGSKRSAHSNAYFYGLPWKKHIVIYDTLIEKTETTEIVAILAHELG
HWKLGHTTRLFAIAQVHLLYIFSLFSVFVNNASLYSAFGFHRTHPIVIGFILFSDALSPMDCILKLLLNILSRKF
EFEADDFAKRLGYRTHLAASLIKLHAQNLSTMDADPIYATYHYSHPHLSERLKALDWSSSVALTSEKDKVEEDKA
VKASGRDEFLPSSLSLQAFEVVHI
Coding >Ophio5|4891
ATGGATTTTCTCCAGCGCCTCGCGCGGTTCCTCGACCGCCCGCTCTTCCCCTGGAAGAAGCTCATCCTCGGCTTC
TCCATCGGCCAATACGTCTTTGAATCCTTCCTCACGCTACGACAATACCGCGTACTCCTCCAGCGCAAGCCGCCG
GCTGTACTATCCAAAGAGGTATCGCAGGAAACGTTCGACAAATCGCAAGCGTATGGCCGAGCCAAGGCACGCTTC
GAGCTCATCAATGGCCTTTGGGGCCAGCTGCAGAACGTGGCGTTTGTGCAAATGGATGTTCTGCCTGCTCTGTGG
GCCTGGTGCGGTGGCCTGGTTGCCTCGTATGCGCCTGCTTGGTTTGCTGGCGAGATCGGCCATTCTATCGTCTTC
GTCTATGTCTTTATTCTGTTGCAGCAGGTGCTGGGTTTACCGGGGCGCGTCTATCACACTTTTGTTCTCGAGGAG
GCTTTTGGATTCAACAAGCAGACTCCCAAGCTGTTCCTTGCGGACATGGTCAAGACCAATCTTCTCACCGCCGCC
ATCATGCCGCCGATCCTCGCTGCTTTTCTGGCCATTATTCGTCGCACCGGCAGCCAGTTTGTCTTTTACCTCTGG
GCTTTTTCCGCTGCGCTTCAGCTCTTTACCACGACGGCTTATCCCATGTTCATTCAGCCCATCTTCAACAAGCTG
TCGCCTCTGGATGAGGGAGAGCTGAAGACGAGGGTTGAGGGATTGGCTGCCACGCAGAAGTTTCCCCTGCAGGAC
CTCTTTGTCATTGACGGGAGCAAGCGCAGTGCTCATTCGAATGCTTACTTTTATGGCTTGCCGTGGAAGAAGCAC
ATTGTCATTTATGATACGCTCATCGAGAAGACGGAAACGACGGAGATTGTCGCCATTTTGGCCCATGAGCTCGGT
CATTGGAAGCTGGGCCACACCACCCGGCTATTTGCCATTGCTCAAGTCCACCTCCTCTACATCTTCAGCCTCTTC
TCCGTCTTCGTCAACAACGCCTCCCTCTACTCGGCCTTTGGCTTCCACCGCACGCACCCCATCGTCATCGGCTTC
ATCCTCTTCTCCGACGCCCTCTCACCCATGGACTGCATCCTCAAGCTTCTCCTCAACATTCTCTCCCGCAAGTTC
GAGTTCGAGGCAGACGACTTCGCCAAACGACTCGGTTACCGCACCCATCTGGCTGCTTCCCTCATCAAGCTCCAT
GCTCAGAATCTCAGCACCATGGACGCCGATCCCATCTATGCTACTTACCATTACTCTCATCCTCATCTCTCGGAG
AGGCTCAAGGCCCTCGATTGGTCGTCTAGTGTTGCGCTTACGTCGGAAAAGGATAAGGTGGAGGAGGATAAGGCT
GTGAAGGCGTCGGGTCGTGACGAGTTTCTTCCTTCCTCGCTCTCTCTTCAGGCGTTCGAGGTCGTGCACATC
Transcript >Ophio5|4891
ATGGATTTTCTCCAGCGCCTCGCGCGGTTCCTCGACCGCCCGCTCTTCCCCTGGAAGAAGCTCATCCTCGGCTTC
TCCATCGGCCAATACGTCTTTGAATCCTTCCTCACGCTACGACAATACCGCGTACTCCTCCAGCGCAAGCCGCCG
GCTGTACTATCCAAAGAGGTATCGCAGGAAACGTTCGACAAATCGCAAGCGTATGGCCGAGCCAAGGCACGCTTC
GAGCTCATCAATGGCCTTTGGGGCCAGCTGCAGAACGTGGCGTTTGTGCAAATGGATGTTCTGCCTGCTCTGTGG
GCCTGGTGCGGTGGCCTGGTTGCCTCGTATGCGCCTGCTTGGTTTGCTGGCGAGATCGGCCATTCTATCGTCTTC
GTCTATGTCTTTATTCTGTTGCAGCAGGTGCTGGGTTTACCGGGGCGCGTCTATCACACTTTTGTTCTCGAGGAG
GCTTTTGGATTCAACAAGCAGACTCCCAAGCTGTTCCTTGCGGACATGGTCAAGACCAATCTTCTCACCGCCGCC
ATCATGCCGCCGATCCTCGCTGCTTTTCTGGCCATTATTCGTCGCACCGGCAGCCAGTTTGTCTTTTACCTCTGG
GCTTTTTCCGCTGCGCTTCAGCTCTTTACCACGACGGCTTATCCCATGTTCATTCAGCCCATCTTCAACAAGCTG
TCGCCTCTGGATGAGGGAGAGCTGAAGACGAGGGTTGAGGGATTGGCTGCCACGCAGAAGTTTCCCCTGCAGGAC
CTCTTTGTCATTGACGGGAGCAAGCGCAGTGCTCATTCGAATGCTTACTTTTATGGCTTGCCGTGGAAGAAGCAC
ATTGTCATTTATGATACGCTCATCGAGAAGACGGAAACGACGGAGATTGTCGCCATTTTGGCCCATGAGCTCGGT
CATTGGAAGCTGGGCCACACCACCCGGCTATTTGCCATTGCTCAAGTCCACCTCCTCTACATCTTCAGCCTCTTC
TCCGTCTTCGTCAACAACGCCTCCCTCTACTCGGCCTTTGGCTTCCACCGCACGCACCCCATCGTCATCGGCTTC
ATCCTCTTCTCCGACGCCCTCTCACCCATGGACTGCATCCTCAAGCTTCTCCTCAACATTCTCTCCCGCAAGTTC
GAGTTCGAGGCAGACGACTTCGCCAAACGACTCGGTTACCGCACCCATCTGGCTGCTTCCCTCATCAAGCTCCAT
GCTCAGAATCTCAGCACCATGGACGCCGATCCCATCTATGCTACTTACCATTACTCTCATCCTCATCTCTCGGAG
AGGCTCAAGGCCCTCGATTGGTCGTCTAGTGTTGCGCTTACGTCGGAAAAGGATAAGGTGGAGGAGGATAAGGCT
GTGAAGGCGTCGGGTCGTGACGAGTTTCTTCCTTCCTCGCTCTCTCTTCAGGCGTTCGAGGTCGTGCACATCTGA
Gene >Ophio5|4891
ATGGATTTTCTCCAGGTACGCCCCCCCCCCCCCCCCCCCCCCCCCCCCCGGAGCTCTACGCTTCCTCCCACCTAC
CTCAAGGACAGACTGCCTAACTCTAGCAGCGCCTCGCGCGGTTCCTCGACCGCCCGCTCTTCCCCTGGAAGAAGC
TCATCCTCGGCTTCTCCATCGGCCAATACGTCTTTGAATCCTTCCTCACGCTACGACAATACCGCGTACTCCTCC
AGCGCAAGCCGCCGGCTGTACTATCCAAAGAGGTATCGCAGGAAACGTTCGACAAATCGCAAGCGTATGGCCGAG
CCAAGGCACGCTTCGAGCTCATCAATGGCCTTTGGGGCCAGCTGCAGAACGTGGCGTTTGTGCAAATGGATGTTC
TGCCTGCTCTGTGGGCCTGGTGCGGTGGCCTGGTTGCCTCGTATGCGCCTGCTTGGTTTGCTGGCGAGATCGGCC
ATTCTATCGTCTTCGTCTATGTCTTTATTCTGTTGCAGCAGGTGCTGGGTTTACCGGGGCGCGTCTATCACACTT
TTGTTCTCGAGGAGGCTTTTGGATTCAACAAGCAGACTCCCAAGCTGTTCCTTGCGGACATGGTCAAGACCAATC
TTCTCACCGCCGCCATCATGCCGCCGATCCTCGCTGCTTTTCTGGCCATTATTCGTCGCACCGGCAGCCAGTTTG
TCTTTTACCTCTGGGCTTTTTCCGCTGCGCTTCAGCTCTTTACCACGACGGCTTATCCCATGTTCATTCAGCCCA
TCTTCAACAAGCTGTCGCCTCTGGATGAGGGAGAGCTGAAGACGAGGGTTGAGGGATTGGCTGCCACGCAGAAGT
TTCCCCTGCAGGACCTCTTTGTCATTGACGGGAGCAAGCGCAGTGCTCATTCGAATGCTTACTTTTATGGCTTGC
CGTGGAAGAAGCACATTGTCATTTATGATACGCTCATCGAGAAGACGGAAACGACGGAGATTGTCGCCATTTTGG
CCCATGAGCTCGGTCATTGGAAGCTGGGCCACACCACCCGGCTATTTGCCATTGCTCAAGTATGCCTGCCTCTTT
TCCCCCTGGGCTGTTGTTCGCTTTTCACCCTTTTACCCGAAATGCCCAACTTACCATCATGTCCCAGGTCCACCT
CCTCTACATCTTCAGCCTCTTCTCCGTCTTCGTCAACAACGCCTCCCTCTACTCGGCCTTTGGCTTCCACCGCAC
GCACCCCATCGTCATCGGCTTCATCCTCTTCTCCGACGCCCTCTCACCCATGGACTGCATCCTCAAGCTTCTCCT
CAACATTCTCTCCCGCAAGTTCGAGTTCGAGGCAGACGACTTCGCCAAACGACTCGGTTACCGCACCCATCTGGC
TGCTTCCCTCATCAAGCTCCATGCTCAGAATCTCAGCACCATGGACGCCGATCCCATCTATGCTACTTACCATTA
CTCTCATCCTCATCTCTCGGAGAGGCTCAAGGCCCTCGATTGGTCGTCTAGTGTTGCGCTTACGTCGGAAAAGGA
TAAGGTGGAGGAGGATAAGGCTGTGAAGGCGTCGGGTCGTGACGAGTTGTAAGGTCGTGCTACGCCTACGACTAT
GCTGAAAGATTGATCAGTCTTCCTTCCTCGCTCTCTCTTCAGGCGTTCGAGGTCGTGCACATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail