Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|489
Gene name
Locationscaffold_111:38209..39985
Strand+
Gene length (bp)1776
Transcript length (bp)1656
Coding sequence length (bp)1653
Protein length (aa) 551

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00098 zf-CCHC Zinc knuckle 9.6E-06 17 33

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0008270 zinc ion binding Yes
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, CCHC-type

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|489
MTESAHGRHCGQAQEPRCYNCGSHGHWAVACPEPTRETPAGLAAWRSASAANQGHGKNHGYSSGSKRSKGPIITK
YSPPSFASPMGPYPPPPSLPPTGNQPPSGLYPAQPYPLLFPPSYPQPVLSYHASVQFAPPAPYCMPHYGQPAHPG
FPGPLPPPPSPLAPNLEYMPPHPPYHALFPPLAPSHKIAHPKASPPHGRQAELAPSIGKPPTAILSHPLPPKPPP
SHDQMKPQRDYKQKRKSDRHHYQEKNSKSFRSNGFKAPNSRAHGSPPADRSPPGYSPVHGRLGNGDAELSSFADA
RHASRSPEKQADEVQASVVTKAEDKAGADVVEKCADGNELASTEEGYSPRPVDGTDGREKPLSPRSQEMGTSEVE
LAAFDNAASATVEASDEQEDGEVSSNEDTLSPVLHHQAVADERGNSPAVEDRWRRKRRYSDEWDDDESYAKRARP
NGTSRVHDRTSDDDLWDSLNVPRQADRKRRGSAASRGSRHSSVSSKSSDLNSLEAELLGRPVKQRQTEEASPPSR
TRSERRPVSKPKRRQTNTNSAYSRRW
Coding >Ophio5|489
ATGACAGAATCAGCGCATGGCCGCCACTGCGGCCAGGCCCAAGAACCCCGATGCTACAACTGCGGCTCTCATGGC
CACTGGGCCGTCGCATGTCCCGAGCCGACGCGGGAGACGCCTGCTGGTCTGGCCGCCTGGAGGAGTGCATCGGCC
GCCAACCAGGGTCATGGCAAGAACCATGGCTACAGTTCCGGCTCTAAGAGGTCCAAGGGGCCCATCATCACCAAG
TACTCACCTCCTTCCTTCGCGTCGCCCATGGGACCATACCCGCCGCCGCCGTCTCTTCCACCTACCGGAAACCAG
CCGCCCTCGGGGCTCTATCCCGCCCAGCCCTACCCTCTCCTGTTCCCGCCGAGCTACCCGCAGCCTGTCTTGTCC
TATCACGCCTCCGTCCAGTTTGCGCCACCGGCTCCCTATTGTATGCCTCATTACGGTCAGCCCGCACATCCGGGC
TTTCCAGGTCCGCTGCCACCGCCACCAAGCCCTCTTGCGCCGAACCTCGAATACATGCCACCTCACCCGCCTTAC
CATGCCTTATTCCCTCCTCTGGCTCCCTCCCACAAGATTGCACATCCAAAGGCTTCTCCCCCTCACGGCCGGCAG
GCGGAGTTGGCGCCCTCCATCGGCAAGCCGCCCACTGCCATACTCAGTCACCCCCTTCCGCCAAAACCTCCGCCA
AGTCATGACCAGATGAAGCCGCAGCGCGACTACAAACAAAAACGGAAAAGCGACCGTCACCATTATCAGGAAAAG
AACTCCAAGAGCTTCCGATCCAACGGTTTCAAGGCGCCCAACTCGAGAGCGCACGGCTCGCCTCCTGCCGATCGC
TCCCCGCCGGGTTACTCGCCGGTCCACGGGCGGCTAGGGAACGGAGATGCCGAGCTCAGCAGCTTCGCAGACGCA
CGTCACGCGTCTCGGTCGCCCGAGAAACAAGCCGATGAGGTGCAAGCCTCAGTCGTGACAAAAGCAGAGGATAAG
GCCGGTGCTGACGTCGTCGAAAAGTGCGCCGATGGCAACGAGTTGGCGAGTACTGAAGAAGGATATTCGCCTCGA
CCCGTTGACGGAACGGATGGCCGAGAGAAGCCGCTTTCGCCGCGCAGTCAGGAAATGGGGACCAGTGAAGTGGAG
TTGGCCGCCTTCGACAATGCAGCTTCCGCCACCGTGGAAGCTAGTGACGAGCAGGAAGACGGCGAAGTCTCCAGC
AATGAAGACACCCTGAGCCCTGTTCTTCATCACCAAGCCGTAGCCGACGAGAGGGGCAACTCGCCGGCCGTCGAG
GACCGCTGGAGACGGAAACGCCGCTATAGCGACGAATGGGACGACGACGAATCGTATGCGAAGAGGGCGAGGCCA
AACGGCACGTCGCGTGTTCACGACAGGACCAGCGACGACGACCTCTGGGACTCGCTCAACGTGCCGAGACAGGCC
GACCGGAAGAGACGCGGGTCGGCAGCCTCGCGCGGGTCGCGGCACTCGTCCGTCTCTAGCAAGTCATCGGACCTC
AACTCGCTCGAGGCCGAGCTGCTGGGCCGGCCGGTGAAGCAGAGACAGACAGAGGAAGCCAGTCCGCCTTCACGG
ACGCGGTCGGAGCGCAGGCCCGTCTCCAAGCCCAAGCGGAGGCAGACAAATACCAACTCGGCTTATAGTCGCCGA
TGG
Transcript >Ophio5|489
ATGACAGAATCAGCGCATGGCCGCCACTGCGGCCAGGCCCAAGAACCCCGATGCTACAACTGCGGCTCTCATGGC
CACTGGGCCGTCGCATGTCCCGAGCCGACGCGGGAGACGCCTGCTGGTCTGGCCGCCTGGAGGAGTGCATCGGCC
GCCAACCAGGGTCATGGCAAGAACCATGGCTACAGTTCCGGCTCTAAGAGGTCCAAGGGGCCCATCATCACCAAG
TACTCACCTCCTTCCTTCGCGTCGCCCATGGGACCATACCCGCCGCCGCCGTCTCTTCCACCTACCGGAAACCAG
CCGCCCTCGGGGCTCTATCCCGCCCAGCCCTACCCTCTCCTGTTCCCGCCGAGCTACCCGCAGCCTGTCTTGTCC
TATCACGCCTCCGTCCAGTTTGCGCCACCGGCTCCCTATTGTATGCCTCATTACGGTCAGCCCGCACATCCGGGC
TTTCCAGGTCCGCTGCCACCGCCACCAAGCCCTCTTGCGCCGAACCTCGAATACATGCCACCTCACCCGCCTTAC
CATGCCTTATTCCCTCCTCTGGCTCCCTCCCACAAGATTGCACATCCAAAGGCTTCTCCCCCTCACGGCCGGCAG
GCGGAGTTGGCGCCCTCCATCGGCAAGCCGCCCACTGCCATACTCAGTCACCCCCTTCCGCCAAAACCTCCGCCA
AGTCATGACCAGATGAAGCCGCAGCGCGACTACAAACAAAAACGGAAAAGCGACCGTCACCATTATCAGGAAAAG
AACTCCAAGAGCTTCCGATCCAACGGTTTCAAGGCGCCCAACTCGAGAGCGCACGGCTCGCCTCCTGCCGATCGC
TCCCCGCCGGGTTACTCGCCGGTCCACGGGCGGCTAGGGAACGGAGATGCCGAGCTCAGCAGCTTCGCAGACGCA
CGTCACGCGTCTCGGTCGCCCGAGAAACAAGCCGATGAGGTGCAAGCCTCAGTCGTGACAAAAGCAGAGGATAAG
GCCGGTGCTGACGTCGTCGAAAAGTGCGCCGATGGCAACGAGTTGGCGAGTACTGAAGAAGGATATTCGCCTCGA
CCCGTTGACGGAACGGATGGCCGAGAGAAGCCGCTTTCGCCGCGCAGTCAGGAAATGGGGACCAGTGAAGTGGAG
TTGGCCGCCTTCGACAATGCAGCTTCCGCCACCGTGGAAGCTAGTGACGAGCAGGAAGACGGCGAAGTCTCCAGC
AATGAAGACACCCTGAGCCCTGTTCTTCATCACCAAGCCGTAGCCGACGAGAGGGGCAACTCGCCGGCCGTCGAG
GACCGCTGGAGACGGAAACGCCGCTATAGCGACGAATGGGACGACGACGAATCGTATGCGAAGAGGGCGAGGCCA
AACGGCACGTCGCGTGTTCACGACAGGACCAGCGACGACGACCTCTGGGACTCGCTCAACGTGCCGAGACAGGCC
GACCGGAAGAGACGCGGGTCGGCAGCCTCGCGCGGGTCGCGGCACTCGTCCGTCTCTAGCAAGTCATCGGACCTC
AACTCGCTCGAGGCCGAGCTGCTGGGCCGGCCGGTGAAGCAGAGACAGACAGAGGAAGCCAGTCCGCCTTCACGG
ACGCGGTCGGAGCGCAGGCCCGTCTCCAAGCCCAAGCGGAGGCAGACAAATACCAACTCGGCTTATAGTCGCCGA
TGGTAG
Gene >Ophio5|489
ATGACAGAATCAGCGCATGGCCGCCACTGCGGCCAGGCCCAAGAACCCCGATGCTACAACTGCGGCTCTCATGGC
CACTGGGCCGTCGCATGTCCCGAGCCGACGCGGGAGACGCCTGCGTGAGCCTCTCCTTGTCTCCCCTCATGGGCT
CATGTCTGCTAACTCGAACCTTGTTGCTTCCAGTGGTCTGGCCGCCTGGAGGAGTGCATCGGCCGCCAACCAGGG
TCATGGCAAGAACCATGGCTACAGTTCCGGCTCTAAGAGGTCCAAGGGGCCCATCATCACCAAGTACTCACCTCC
TTCCTTCGCGTCGCCCATGGGACCATACCCGCCGCCGCCGTCTCTTCCACCTACCGGAAACCAGCCGCCCTCGGG
GCTCTATCCCGCCCAGCCCTACCCTCTCCTGTTCCCGCCGAGCTACCCGCAGCCTGTCTTGTCCTATCACGCCTC
CGTCCAGTTTGCGCCACCGGCTCCCTATTGTATGCCTCATTACGGTCAGCCCGCACATCCGGGCTTTCCAGGTCC
GCTGCCACCGCCACCAAGCCCTCTTGCGCCGAACCTCGAATACATGCCACCTCACCCGCCTTACCATGCCTTATT
CCCTCCTCTGGCTCCCTCCCACAAGATTGCACATCCAAAGGCTTCTCCCCCTCACGGCCGGCAGGCGGAGTTGGC
GCCCTCCATCGGCAAGCCGCCCACTGCCATACTCAGTCACCCCCTTCCGCCAAAACCTCCGCCAAGTCATGACCA
GATGAAGCCGCAGCGCGACTACAAACAAAAACGGAAAAGCGACCGTCACCATTATCAGGAAAAGAACTCCAAGAG
CTTCCGATCCAACGGTTTCAAGGCGCCCAACTCGAGAGCGCACGGCTCGCCTCCTGCCGATCGCTCCCCGCCGGG
TTACTCGCCGGTCCACGGGCGGCTAGGGAACGGAGATGCCGAGCTCAGCAGCTTCGCAGACGCACGTCACGCGTC
TCGGTCGCCCGAGAAACAAGCCGATGAGGTGCAAGCCTCAGTCGTGACAAAAGCAGAGGATAAGGCCGGTGCTGA
CGTCGTCGAAAAGTGCGCCGATGGCAACGAGTTGGCGAGTACTGAAGAAGGATATTCGCCTCGACCCGTTGACGG
AACGGATGGCCGAGAGAAGCCGCTTTCGCCGCGCAGTCAGGAAATGGGGACCAGTGAAGTGGAGTTGGCCGCCTT
CGACAATGCAGCTTCCGCCACCGTGGAAGCTAGTGACGAGCAGGAAGACGGCGAAGTCTCCAGCAATGAAGACAC
CCTGAGCCCTGTTCTTCATCACCAAGCCGTAGCCGACGAGAGGGGCAACTCGCCGGCCGTCGAGGACCGCTGGAG
ACGGAAACGCCGCTATAGCGACGAATGGGACGACGACGAATCGTATGCGAAGAGGGCGAGGCCAAACGGCACGTC
GCGTGTTCACGACAGGACCAGCGACGACGACCTCTGGGACTCGCTCAACGTGCCGAGACAGGCCGACCGGAAGAG
ACGCGGGTCGGCAGCCTCGCGCGGGTCGCGGCACTCGTCCGTCTCTAGCAAGTCATCGGACCTCAACTCGCTCGA
GGCCGAGCTGCTGGGCCGGCCGGTGAAGCAGAGACAGACAGAGGAAGCCAGTCCGCCTTCACGGACGCGGTCGGA
GCGCAGGCCCGTCTCCAAGCCCAAGCGGAGGCAGACAAATACCAACTCGGCTTATAGGTATACTGCTGTCCTGTT
TCCGAGAGAGACGTGAACAAGTTCTGACGAGATGACAGTCGCCGATGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail