Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4888
Gene name
Locationscaffold_392:17801..19845
Strand+
Gene length (bp)2044
Transcript length (bp)1548
Coding sequence length (bp)1545
Protein length (aa) 515

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03676 PHAF1 Phagosome assembly factor 1 5.5E-30 17 293
PF03676 PHAF1 Phagosome assembly factor 1 1.1E-11 368 485

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9BSU1|CP070_HUMAN UPF0183 protein C16orf70 OS=Homo sapiens GN=C16orf70 PE=1 SV=1 10 291 6.0E-11
sp|O08654|CP070_RAT UPF0183 protein C16orf70 homolog OS=Rattus norvegicus PE=2 SV=1 10 291 9.0E-11
sp|Q9SD33|U183_ARATH UPF0183 protein At3g51130 OS=Arabidopsis thaliana GN=At3g51130 PE=2 SV=2 8 162 2.0E-09
sp|P34692|U183_CAEEL UPF0183 protein T01G9.2 OS=Caenorhabditis elegans GN=T01G9.2 PE=1 SV=3 17 290 2.0E-09
sp|Q922R1|CP070_MOUSE UPF0183 protein C16orf70 homolog OS=Mus musculus PE=1 SV=2 10 291 3.0E-09

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5854 0.5739 0.2435 0.0265 0.2283 0.0137 0.5438 0.1717 0.3864 0.0209

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup146
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4387
Ophiocordyceps australis 1348a (Ghana) OphauG2|5166
Ophiocordyceps australis map64 (Brazil) OphauB2|6091
Ophiocordyceps australis map64 (Brazil) OphauB2|6092
Ophiocordyceps australis map64 (Brazil) OphauB2|6093
Ophiocordyceps australis map64 (Brazil) OphauB2|87
Ophiocordyceps camponoti-floridani Ophcf2|02677
Ophiocordyceps camponoti-rufipedis Ophun1|4371
Ophiocordyceps kimflemingae Ophio5|2062
Ophiocordyceps kimflemingae Ophio5|4888 (this protein)
Ophiocordyceps kimflemingae Ophio5|8395
Ophiocordyceps subramaniannii Hirsu2|5226
Ophiocordyceps subramaniannii Hirsu2|9012

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4888
MSLFTAQLHPGRALGFLALGASLHDVLTRLKAEPQRFPKLEVVYSPEQPVTEPVCVVLPQNGVRLRFDGPTQRLR
LIEVTDFTKNHITFKDRDLLKPAANGGGTLSAPTGTQSSPAPGPSFRHIYHRVLGPTYAGEFIPPGSGGGDGIYV
LSYPGVAFNFALAEAAYSPDKDVVTLLAAASSQAATSMAIFSGNSWAEARPELWTGPLPSVRLPSSVVVGGGGRS
RDSYPEEVSLVRLRGGGRIDMVRKWTGSGPVFRLQLGETTAQDLVMALGPPSAMYRKNDQKMVIHTMRAAVGGGA
RGARASTSAAKADALTDTDQSSMNTASDESGDGDDDDDDDDDDDDDDDDDDDDDDDDDDEQDHGGSSSYGSSGEC
FYNYFYLGFDILLSTPTAGKGSFGTGSGIKNQHPDRLVATKLVLHGNIPGCYEFNRHRRCRWELRRPDSFPSSDE
VAADSETEFKLIEERLSQQWGDRSARQRGMVLNRGWGDSPGSSCEFLGGWEESDEGGGRAEAAMS
Coding >Ophio5|4888
ATGTCCCTATTCACGGCGCAGCTGCACCCCGGGCGAGCGCTCGGGTTCCTGGCACTCGGGGCGTCGCTGCACGAT
GTGCTGACGAGGCTCAAGGCGGAGCCCCAGCGGTTCCCGAAGCTCGAGGTGGTGTATTCGCCGGAGCAGCCGGTG
ACGGAGCCGGTGTGCGTCGTGCTTCCGCAGAACGGCGTGCGGCTGCGGTTCGACGGGCCGACGCAGCGGCTACGA
CTGATCGAGGTGACGGACTTTACCAAGAATCACATCACTTTCAAGGACCGAGACCTGCTAAAGCCTGCGGCCAAC
GGAGGGGGTACGCTGTCAGCCCCCACGGGCACACAGTCGTCACCGGCGCCCGGTCCGTCCTTTCGACACATCTAT
CATCGAGTCCTGGGGCCGACGTACGCGGGCGAATTCATCCCGCCGGGGTCGGGGGGCGGAGACGGCATCTACGTG
CTGTCCTACCCGGGCGTGGCCTTTAACTTCGCCCTGGCCGAGGCGGCCTACTCGCCGGACAAGGACGTGGTGACG
TTATTGGCGGCGGCCTCGAGCCAGGCAGCCACGTCCATGGCCATCTTCAGCGGCAACTCGTGGGCCGAGGCGCGG
CCGGAGCTGTGGACGGGTCCGCTGCCGAGCGTGCGCCTGCCGTCGTCGGTGGTGGTGGGCGGCGGAGGTCGGTCG
AGAGACTCGTACCCGGAAGAGGTGTCGCTGGTGAGGCTCCGCGGCGGCGGACGCATCGACATGGTGCGCAAGTGG
ACCGGCTCCGGACCCGTCTTCCGGCTGCAGCTGGGCGAGACGACGGCGCAGGATCTGGTCATGGCGCTGGGGCCG
CCGAGTGCCATGTACCGAAAGAACGACCAGAAGATGGTGATTCACACGATGCGCGCTGCTGTTGGCGGAGGAGCA
CGTGGCGCGCGGGCGTCGACATCGGCGGCCAAGGCGGACGCTCTCACCGACACGGACCAGTCGTCGATGAATACA
GCATCGGACGAGTCGGGCGACGGCGATGACGACGACGACGACGACGACGACGACGACGATGACGATGACGACGAC
GATGACGACGACGACGACGACGACGACGAACAGGATCACGGCGGCAGCAGCAGCTACGGCTCCTCGGGCGAGTGC
TTCTACAACTATTTCTATCTAGGCTTCGACATTCTTCTCTCGACGCCGACGGCTGGGAAAGGTAGCTTCGGCACC
GGCAGCGGCATCAAAAACCAGCACCCAGACCGACTCGTGGCCACAAAGTTGGTCCTCCACGGCAACATCCCGGGC
TGCTACGAATTCAACCGACACCGTCGATGCCGGTGGGAACTCCGCCGACCCGACTCCTTCCCCTCGTCGGACGAG
GTGGCAGCAGACTCGGAGACGGAGTTCAAGCTGATCGAGGAGCGGCTCTCGCAGCAGTGGGGGGACCGGTCGGCG
CGTCAGAGGGGTATGGTCCTCAACCGCGGCTGGGGCGACAGTCCGGGTAGCAGCTGCGAGTTCCTCGGCGGCTGG
GAGGAGAGCGATGAGGGGGGGGGGAGGGCCGAGGCGGCCATGTCC
Transcript >Ophio5|4888
ATGTCCCTATTCACGGCGCAGCTGCACCCCGGGCGAGCGCTCGGGTTCCTGGCACTCGGGGCGTCGCTGCACGAT
GTGCTGACGAGGCTCAAGGCGGAGCCCCAGCGGTTCCCGAAGCTCGAGGTGGTGTATTCGCCGGAGCAGCCGGTG
ACGGAGCCGGTGTGCGTCGTGCTTCCGCAGAACGGCGTGCGGCTGCGGTTCGACGGGCCGACGCAGCGGCTACGA
CTGATCGAGGTGACGGACTTTACCAAGAATCACATCACTTTCAAGGACCGAGACCTGCTAAAGCCTGCGGCCAAC
GGAGGGGGTACGCTGTCAGCCCCCACGGGCACACAGTCGTCACCGGCGCCCGGTCCGTCCTTTCGACACATCTAT
CATCGAGTCCTGGGGCCGACGTACGCGGGCGAATTCATCCCGCCGGGGTCGGGGGGCGGAGACGGCATCTACGTG
CTGTCCTACCCGGGCGTGGCCTTTAACTTCGCCCTGGCCGAGGCGGCCTACTCGCCGGACAAGGACGTGGTGACG
TTATTGGCGGCGGCCTCGAGCCAGGCAGCCACGTCCATGGCCATCTTCAGCGGCAACTCGTGGGCCGAGGCGCGG
CCGGAGCTGTGGACGGGTCCGCTGCCGAGCGTGCGCCTGCCGTCGTCGGTGGTGGTGGGCGGCGGAGGTCGGTCG
AGAGACTCGTACCCGGAAGAGGTGTCGCTGGTGAGGCTCCGCGGCGGCGGACGCATCGACATGGTGCGCAAGTGG
ACCGGCTCCGGACCCGTCTTCCGGCTGCAGCTGGGCGAGACGACGGCGCAGGATCTGGTCATGGCGCTGGGGCCG
CCGAGTGCCATGTACCGAAAGAACGACCAGAAGATGGTGATTCACACGATGCGCGCTGCTGTTGGCGGAGGAGCA
CGTGGCGCGCGGGCGTCGACATCGGCGGCCAAGGCGGACGCTCTCACCGACACGGACCAGTCGTCGATGAATACA
GCATCGGACGAGTCGGGCGACGGCGATGACGACGACGACGACGACGACGACGACGACGATGACGATGACGACGAC
GATGACGACGACGACGACGACGACGACGAACAGGATCACGGCGGCAGCAGCAGCTACGGCTCCTCGGGCGAGTGC
TTCTACAACTATTTCTATCTAGGCTTCGACATTCTTCTCTCGACGCCGACGGCTGGGAAAGGTAGCTTCGGCACC
GGCAGCGGCATCAAAAACCAGCACCCAGACCGACTCGTGGCCACAAAGTTGGTCCTCCACGGCAACATCCCGGGC
TGCTACGAATTCAACCGACACCGTCGATGCCGGTGGGAACTCCGCCGACCCGACTCCTTCCCCTCGTCGGACGAG
GTGGCAGCAGACTCGGAGACGGAGTTCAAGCTGATCGAGGAGCGGCTCTCGCAGCAGTGGGGGGACCGGTCGGCG
CGTCAGAGGGGTATGGTCCTCAACCGCGGCTGGGGCGACAGTCCGGGTAGCAGCTGCGAGTTCCTCGGCGGCTGG
GAGGAGAGCGATGAGGGGGGGGGGAGGGCCGAGGCGGCCATGTCCTAG
Gene >Ophio5|4888
ATGTCCCTATTCACGGCGCAGCTGCACCCCGGGCGAGCGCTCGGGTTCCTGGGTAAGGAACGACAACGACAACGA
CAACAACAACAACAACAACCACAAAGACTCTGCAGCTAGAAATACGTGCTGACTTGGACAACAGCACTCGGGGCG
TCGCTGCACGATGTGCTGACGAGGCTCAAGGCGGAGCCCCAGCGGTTCCCGAAGCTCGAGGTGGTGTATTCGCCG
GAGCAGCCGGTGACGGAGCCGGTGTGCGTCGTGCTTCCGCAGAACGGCGTGCGGCTGCGGTTCGACGGGCCGACG
CAGCGGCTACGACTGATCGAGGTGACGGACTTTACCAAGAATCACATCACTTTCAAGGACCGAGACCTGCTAAAG
CCTGCGGCCAACGGAGGGGGTACGCTGTCAGCCCCCACGGGCACACAGTCGTCACCGGCGCCCGGTCCGTCCTTT
CGACACATCTATCATCGAGTCCTGGGGCCGACGTACGCGGGCGAATTCATCCCGCCGGGGTCGGGGGGCGGAGAC
GGCATCTACGTGCTGTCCTACCCGGGCGTGGCCTTTAACTTCGCCCTGGCCGAGGCGGCCTACTCGCCGGACAAG
GACGTGGTGACGTTATTGGCGGCGGCCTCGAGCCAGGCAGCCACGTCCATGGCCATCTTCAGCGGCAACTCGTGG
GCCGAGGCGCGGCCGGAGCTGTGGACGGGTCCGCTGCCGAGCGTGCGCCTGCCGTCGTCGGTGGTGGTGGGCGGC
GGAGGTCGGTCGAGAGACTCGTACCCGGAAGAGGTGTCGCTGGTGAGGCTCCGCGGCGGCGGACGCATCGACATG
GTGCGCAAGTGGACCGGCTCCGGACCCGTCTTCCGGCTGCAGCTGGGCGAGACGACGGCGCAGGATCTGGTCATG
GCGCTGGGGCCGCCGAGTGCCATGTACCGAAAGAACGACCAGAAGATGGTGATTCACACGATGCGCGCTGCTGTT
GGCGGAGGAGCACGTGGCGCGCGGGCGTCGACATCGGCGGCCAAGGCGGACGCTCTCACCGACACGGACCAGTCG
TCGATGAATACAGCATCGGACGAGTCGGGCGACGGCGATGACGACGACGACGACGACGACGACGACGACGATGAC
GATGACGACGACGATGACGACGACGACGACGACGACGACGAACAGGATCACGGCGGCAGCAGCAGCTACGGCTCC
TCGGGCGAGTGCTTCTACAACTATTTCTATCTAGGCTTCGACATTCTTCTCTCGACGCCGACGGCTGGGAAAGGT
AGCTTCGGCACCGGCAGCGGCATCAAAAACCAGCACCCAGACCGACTCGTGGCCACAAAGTTGGTCCTCCACGGC
AACATCCCGGGCTGCTACGAATTCAACCGACACCGTCGATGCCGGTGGGAACTCCGCCGACCCGACTCCTTCCCC
TCGTCGGACGAGGTGGCAGCAGACTCGGAGACGGAGTTCAAGCTGATCGAGGAGCGGCTCTCGCAGCAGTGGGGG
GACCGGTCGGCGCGTCAGAGGGGTATGGTCCTCAACCGCGGCTGGGGCGACAGTCCGGGTAGCAGCTGCGAGTTC
CTCGGCGGCTGGGAGGAGAGCGATGAGGGGGGGGGGAGGGCCGAGGCGGGTGGAGGAGGAGGAGGAGGANNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCCCCCCCCC
CCTCCCATTGAAGCTGACGACATTGAGCTTCTTGACCGCATCTGTTGTGCACCGTTGTTGCATTATTCAGGTCTT
TTACACAGAGACTCGGGTTCCGTTCCGGGTTGTTTTGCTGCTTACTGCCGTGTTGATCTTTTTTTGCTCGCGACT
CCATCCAAGTCTTTGTACGTGCGCGTCATATGGCAAGCATGTCTCTCGACGGGTTTCCCTTCTATCGTATAAACC
AAGACTAGCCATGTCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail