Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4879
Gene name
Locationscaffold_391:15991..18307
Strand+
Gene length (bp)2316
Transcript length (bp)2316
Coding sequence length (bp)2313
Protein length (aa) 771

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01553 Acyltransferase Acyltransferase 4.4E-05 234 293

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7P0|YOL4_SCHPO Uncharacterized acyltransferase C1718.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1718.04 PE=1 SV=1 24 658 3.0E-164
sp|P32784|GPT1_YEAST Glycerol-3-phosphate O-acyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCT1 PE=1 SV=3 9 612 4.0E-153
sp|P36148|GPT2_YEAST Glycerol-3-phosphate O-acyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPT2 PE=1 SV=1 18 609 7.0E-131

GO

GO Term Description Terminal node
GO:0016746 acyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

Domain # Start End Length
1 444 463 19
2 494 516 22
3 531 553 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 65.31 35.08 95.54
CcL In ants, during behavior modification 46.50 25.10 67.91
CcD In ants, recently dead 70.32 35.21 105.44

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.136045 no
SC16a CcD 0.793607 no
CcL CcD 0.075229 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4879
MSLGEERGRRPPGPGKELYPMVKWKYDLFLYSMGNMVDLFFREVVPRGSWKVPQSGPVLFVAAPHANQFVDAIIL
QRTLRHEAARRVSLLIAQKSVHGFIGWASRQVGSVPVGRAQDAATPATGTIYLPDPVADPTLVRGIGTRFGEGEG
EPQGMLFLPPGKKTSGASVDIAQIIGPEELRIKRPFKGKLAMQQLTGRDDVDDEGRLTHTEVRGPAPGYEGTRFK
VAPHIDQTKVYEAVFARLRNGGCVGIFPEGGSHDRTELLPLKAGVAIMALGALAESPDCGLKIVPVGMNYFHAHK
FRSRAVVEFGTPFEIPSHVVELYRNNRRREAIGQVLDTVYQALSSVTVSAPDYDTLMLVQAARRLYNPTGKKLPL
PVVVELNRRLAMGYERYKDDERITSLSRAVKSYNQQLRYLNLKDHQVQYARMSLLKVLFLIVYRSAKLAVLLAFT
VPGLLLFAPVFAASKVISRRKAKTALAGSTVKIRGHDVMATWKILVALGLAPTLYHAYSIAVVALVWHDRLWGRV
PGWVPLWLVYLGAWPVMIGMTLAALRFGEVGMDIFKSLRPLVLCLLPTSSFNIHKLRVRRAELSVQVTELINELG
PDMFADFDKTRLIPDMTRVEGAGSQAGTAAAAEPQRRPSDSDQWNGEFVCEVESPPSLSRRSTTQSSRRLPRNDS
FSNIGAVGIFSTRPPSRSRSRSRSSSAGGGLGMSGFPLGAFTTLDSAEGLNEATRKIREAMKDRRRRSDKLRVED
DDDERDSEAEGEYEEARKKRV
Coding >Ophio5|4879
ATGTCTCTCGGCGAGGAGCGCGGCAGACGGCCGCCCGGCCCGGGCAAGGAGCTGTATCCCATGGTCAAATGGAAA
TACGACTTGTTCCTCTACAGCATGGGAAACATGGTTGACTTGTTCTTCCGCGAGGTCGTGCCCCGGGGCTCGTGG
AAGGTGCCGCAATCGGGGCCCGTGCTGTTCGTCGCGGCGCCACACGCCAACCAGTTCGTCGACGCCATCATCCTC
CAGCGGACCCTTAGGCACGAGGCCGCCCGGCGCGTGTCGCTCCTCATCGCCCAGAAATCCGTCCACGGCTTCATC
GGTTGGGCTTCGCGCCAGGTTGGCTCCGTGCCCGTCGGCCGGGCCCAGGACGCGGCCACGCCGGCAACCGGTACC
ATCTATCTTCCCGACCCGGTCGCGGACCCTACGCTGGTCCGGGGAATCGGCACCCGCTTCGGCGAGGGCGAGGGC
GAGCCGCAGGGCATGCTGTTCCTCCCGCCCGGCAAGAAGACGTCGGGCGCCAGCGTCGATATCGCCCAGATCATC
GGCCCGGAGGAGTTGCGCATCAAGCGACCATTCAAGGGCAAGCTCGCCATGCAGCAACTGACGGGCCGCGACGAC
GTCGACGACGAGGGTAGGCTGACTCACACCGAGGTCAGGGGCCCCGCGCCCGGCTACGAGGGCACCCGCTTCAAG
GTGGCGCCGCACATCGACCAGACCAAGGTGTACGAGGCCGTCTTCGCCCGGCTGCGCAACGGCGGCTGCGTCGGC
ATCTTTCCCGAGGGCGGCAGCCACGACCGCACCGAGCTGCTGCCGCTCAAGGCGGGCGTCGCCATCATGGCGCTG
GGCGCGCTGGCCGAGTCGCCCGACTGCGGGCTCAAGATTGTGCCGGTTGGCATGAACTACTTTCACGCCCACAAG
TTCCGCTCGCGCGCCGTCGTCGAGTTTGGCACACCGTTCGAGATCCCTTCACACGTGGTGGAACTATATCGCAAC
AACCGGCGACGCGAGGCCATCGGACAGGTGCTCGACACCGTCTACCAGGCCCTGAGCTCGGTGACGGTGTCGGCG
CCCGACTACGACACGCTGATGCTGGTGCAGGCGGCGCGGCGGCTGTACAACCCGACGGGTAAGAAGCTGCCGCTG
CCCGTCGTCGTCGAGCTCAACCGGCGGCTGGCCATGGGCTACGAGCGCTACAAGGACGACGAGCGCATCACGTCG
CTGTCGCGGGCGGTCAAGAGCTACAACCAGCAGCTGCGGTACCTGAACCTCAAGGACCACCAGGTGCAGTATGCG
CGCATGTCGCTGCTCAAGGTGCTCTTTCTCATCGTCTACCGGTCGGCCAAGCTGGCGGTCCTGCTGGCATTTACG
GTGCCGGGCCTGCTGCTCTTCGCTCCCGTCTTCGCCGCTTCCAAGGTCATCAGCCGGCGCAAGGCCAAGACGGCG
CTGGCGGGCTCGACGGTCAAGATTCGCGGGCACGACGTCATGGCGACGTGGAAGATCCTGGTGGCGCTGGGGCTG
GCCCCGACGCTCTACCACGCCTACTCCATCGCCGTCGTGGCCCTGGTGTGGCACGACCGGCTCTGGGGCCGGGTG
CCGGGCTGGGTGCCGCTGTGGCTGGTATACCTGGGCGCGTGGCCCGTCATGATTGGCATGACGCTCGCGGCGCTG
CGCTTCGGCGAGGTGGGCATGGACATTTTCAAGTCGCTACGGCCGCTGGTGCTGTGCCTGCTGCCGACGTCGTCG
TTTAACATACACAAGCTGCGCGTCAGGCGGGCGGAGCTGAGCGTGCAGGTGACGGAACTGATCAACGAGCTCGGG
CCAGACATGTTTGCCGACTTTGACAAGACGCGACTGATTCCGGACATGACGAGGGTCGAGGGTGCCGGTTCGCAG
GCCGGCACGGCGGCTGCGGCTGAACCGCAGAGGCGACCCTCGGACAGCGACCAGTGGAACGGCGAATTCGTGTGC
GAGGTGGAGTCGCCACCGTCTTTGTCGAGGCGCAGCACGACGCAATCGAGCCGCAGGCTACCGAGGAACGACTCG
TTCAGCAACATTGGGGCCGTGGGCATCTTCTCGACGCGGCCGCCGTCACGGTCCAGGAGCCGGTCGCGGTCGAGC
AGCGCCGGGGGCGGGCTCGGGATGAGCGGATTCCCGCTGGGCGCCTTTACCACGCTCGACTCGGCCGAAGGGCTC
AATGAGGCGACGAGGAAGATCCGCGAGGCGATGAAGGATCGGCGTAGGCGGTCGGACAAGCTGCGGGTGGAAGAC
GATGACGACGAGAGGGACAGCGAGGCCGAGGGCGAGTACGAGGAGGCGAGGAAGAAGAGGGTG
Transcript >Ophio5|4879
ATGTCTCTCGGCGAGGAGCGCGGCAGACGGCCGCCCGGCCCGGGCAAGGAGCTGTATCCCATGGTCAAATGGAAA
TACGACTTGTTCCTCTACAGCATGGGAAACATGGTTGACTTGTTCTTCCGCGAGGTCGTGCCCCGGGGCTCGTGG
AAGGTGCCGCAATCGGGGCCCGTGCTGTTCGTCGCGGCGCCACACGCCAACCAGTTCGTCGACGCCATCATCCTC
CAGCGGACCCTTAGGCACGAGGCCGCCCGGCGCGTGTCGCTCCTCATCGCCCAGAAATCCGTCCACGGCTTCATC
GGTTGGGCTTCGCGCCAGGTTGGCTCCGTGCCCGTCGGCCGGGCCCAGGACGCGGCCACGCCGGCAACCGGTACC
ATCTATCTTCCCGACCCGGTCGCGGACCCTACGCTGGTCCGGGGAATCGGCACCCGCTTCGGCGAGGGCGAGGGC
GAGCCGCAGGGCATGCTGTTCCTCCCGCCCGGCAAGAAGACGTCGGGCGCCAGCGTCGATATCGCCCAGATCATC
GGCCCGGAGGAGTTGCGCATCAAGCGACCATTCAAGGGCAAGCTCGCCATGCAGCAACTGACGGGCCGCGACGAC
GTCGACGACGAGGGTAGGCTGACTCACACCGAGGTCAGGGGCCCCGCGCCCGGCTACGAGGGCACCCGCTTCAAG
GTGGCGCCGCACATCGACCAGACCAAGGTGTACGAGGCCGTCTTCGCCCGGCTGCGCAACGGCGGCTGCGTCGGC
ATCTTTCCCGAGGGCGGCAGCCACGACCGCACCGAGCTGCTGCCGCTCAAGGCGGGCGTCGCCATCATGGCGCTG
GGCGCGCTGGCCGAGTCGCCCGACTGCGGGCTCAAGATTGTGCCGGTTGGCATGAACTACTTTCACGCCCACAAG
TTCCGCTCGCGCGCCGTCGTCGAGTTTGGCACACCGTTCGAGATCCCTTCACACGTGGTGGAACTATATCGCAAC
AACCGGCGACGCGAGGCCATCGGACAGGTGCTCGACACCGTCTACCAGGCCCTGAGCTCGGTGACGGTGTCGGCG
CCCGACTACGACACGCTGATGCTGGTGCAGGCGGCGCGGCGGCTGTACAACCCGACGGGTAAGAAGCTGCCGCTG
CCCGTCGTCGTCGAGCTCAACCGGCGGCTGGCCATGGGCTACGAGCGCTACAAGGACGACGAGCGCATCACGTCG
CTGTCGCGGGCGGTCAAGAGCTACAACCAGCAGCTGCGGTACCTGAACCTCAAGGACCACCAGGTGCAGTATGCG
CGCATGTCGCTGCTCAAGGTGCTCTTTCTCATCGTCTACCGGTCGGCCAAGCTGGCGGTCCTGCTGGCATTTACG
GTGCCGGGCCTGCTGCTCTTCGCTCCCGTCTTCGCCGCTTCCAAGGTCATCAGCCGGCGCAAGGCCAAGACGGCG
CTGGCGGGCTCGACGGTCAAGATTCGCGGGCACGACGTCATGGCGACGTGGAAGATCCTGGTGGCGCTGGGGCTG
GCCCCGACGCTCTACCACGCCTACTCCATCGCCGTCGTGGCCCTGGTGTGGCACGACCGGCTCTGGGGCCGGGTG
CCGGGCTGGGTGCCGCTGTGGCTGGTATACCTGGGCGCGTGGCCCGTCATGATTGGCATGACGCTCGCGGCGCTG
CGCTTCGGCGAGGTGGGCATGGACATTTTCAAGTCGCTACGGCCGCTGGTGCTGTGCCTGCTGCCGACGTCGTCG
TTTAACATACACAAGCTGCGCGTCAGGCGGGCGGAGCTGAGCGTGCAGGTGACGGAACTGATCAACGAGCTCGGG
CCAGACATGTTTGCCGACTTTGACAAGACGCGACTGATTCCGGACATGACGAGGGTCGAGGGTGCCGGTTCGCAG
GCCGGCACGGCGGCTGCGGCTGAACCGCAGAGGCGACCCTCGGACAGCGACCAGTGGAACGGCGAATTCGTGTGC
GAGGTGGAGTCGCCACCGTCTTTGTCGAGGCGCAGCACGACGCAATCGAGCCGCAGGCTACCGAGGAACGACTCG
TTCAGCAACATTGGGGCCGTGGGCATCTTCTCGACGCGGCCGCCGTCACGGTCCAGGAGCCGGTCGCGGTCGAGC
AGCGCCGGGGGCGGGCTCGGGATGAGCGGATTCCCGCTGGGCGCCTTTACCACGCTCGACTCGGCCGAAGGGCTC
AATGAGGCGACGAGGAAGATCCGCGAGGCGATGAAGGATCGGCGTAGGCGGTCGGACAAGCTGCGGGTGGAAGAC
GATGACGACGAGAGGGACAGCGAGGCCGAGGGCGAGTACGAGGAGGCGAGGAAGAAGAGGGTGTGA
Gene >Ophio5|4879
ATGTCTCTCGGCGAGGAGCGCGGCAGACGGCCGCCCGGCCCGGGCAAGGAGCTGTATCCCATGGTCAAATGGAAA
TACGACTTGTTCCTCTACAGCATGGGAAACATGGTTGACTTGTTCTTCCGCGAGGTCGTGCCCCGGGGCTCGTGG
AAGGTGCCGCAATCGGGGCCCGTGCTGTTCGTCGCGGCGCCACACGCCAACCAGTTCGTCGACGCCATCATCCTC
CAGCGGACCCTTAGGCACGAGGCCGCCCGGCGCGTGTCGCTCCTCATCGCCCAGAAATCCGTCCACGGCTTCATC
GGTTGGGCTTCGCGCCAGGTTGGCTCCGTGCCCGTCGGCCGGGCCCAGGACGCGGCCACGCCGGCAACCGGTACC
ATCTATCTTCCCGACCCGGTCGCGGACCCTACGCTGGTCCGGGGAATCGGCACCCGCTTCGGCGAGGGCGAGGGC
GAGCCGCAGGGCATGCTGTTCCTCCCGCCCGGCAAGAAGACGTCGGGCGCCAGCGTCGATATCGCCCAGATCATC
GGCCCGGAGGAGTTGCGCATCAAGCGACCATTCAAGGGCAAGCTCGCCATGCAGCAACTGACGGGCCGCGACGAC
GTCGACGACGAGGGTAGGCTGACTCACACCGAGGTCAGGGGCCCCGCGCCCGGCTACGAGGGCACCCGCTTCAAG
GTGGCGCCGCACATCGACCAGACCAAGGTGTACGAGGCCGTCTTCGCCCGGCTGCGCAACGGCGGCTGCGTCGGC
ATCTTTCCCGAGGGCGGCAGCCACGACCGCACCGAGCTGCTGCCGCTCAAGGCGGGCGTCGCCATCATGGCGCTG
GGCGCGCTGGCCGAGTCGCCCGACTGCGGGCTCAAGATTGTGCCGGTTGGCATGAACTACTTTCACGCCCACAAG
TTCCGCTCGCGCGCCGTCGTCGAGTTTGGCACACCGTTCGAGATCCCTTCACACGTGGTGGAACTATATCGCAAC
AACCGGCGACGCGAGGCCATCGGACAGGTGCTCGACACCGTCTACCAGGCCCTGAGCTCGGTGACGGTGTCGGCG
CCCGACTACGACACGCTGATGCTGGTGCAGGCGGCGCGGCGGCTGTACAACCCGACGGGTAAGAAGCTGCCGCTG
CCCGTCGTCGTCGAGCTCAACCGGCGGCTGGCCATGGGCTACGAGCGCTACAAGGACGACGAGCGCATCACGTCG
CTGTCGCGGGCGGTCAAGAGCTACAACCAGCAGCTGCGGTACCTGAACCTCAAGGACCACCAGGTGCAGTATGCG
CGCATGTCGCTGCTCAAGGTGCTCTTTCTCATCGTCTACCGGTCGGCCAAGCTGGCGGTCCTGCTGGCATTTACG
GTGCCGGGCCTGCTGCTCTTCGCTCCCGTCTTCGCCGCTTCCAAGGTCATCAGCCGGCGCAAGGCCAAGACGGCG
CTGGCGGGCTCGACGGTCAAGATTCGCGGGCACGACGTCATGGCGACGTGGAAGATCCTGGTGGCGCTGGGGCTG
GCCCCGACGCTCTACCACGCCTACTCCATCGCCGTCGTGGCCCTGGTGTGGCACGACCGGCTCTGGGGCCGGGTG
CCGGGCTGGGTGCCGCTGTGGCTGGTATACCTGGGCGCGTGGCCCGTCATGATTGGCATGACGCTCGCGGCGCTG
CGCTTCGGCGAGGTGGGCATGGACATTTTCAAGTCGCTACGGCCGCTGGTGCTGTGCCTGCTGCCGACGTCGTCG
TTTAACATACACAAGCTGCGCGTCAGGCGGGCGGAGCTGAGCGTGCAGGTGACGGAACTGATCAACGAGCTCGGG
CCAGACATGTTTGCCGACTTTGACAAGACGCGACTGATTCCGGACATGACGAGGGTCGAGGGTGCCGGTTCGCAG
GCCGGCACGGCGGCTGCGGCTGAACCGCAGAGGCGACCCTCGGACAGCGACCAGTGGAACGGCGAATTCGTGTGC
GAGGTGGAGTCGCCACCGTCTTTGTCGAGGCGCAGCACGACGCAATCGAGCCGCAGGCTACCGAGGAACGACTCG
TTCAGCAACATTGGGGCCGTGGGCATCTTCTCGACGCGGCCGCCGTCACGGTCCAGGAGCCGGTCGCGGTCGAGC
AGCGCCGGGGGCGGGCTCGGGATGAGCGGATTCCCGCTGGGCGCCTTTACCACGCTCGACTCGGCCGAAGGGCTC
AATGAGGCGACGAGGAAGATCCGCGAGGCGATGAAGGATCGGCGTAGGCGGTCGGACAAGCTGCGGGTGGAAGAC
GATGACGACGAGAGGGACAGCGAGGCCGAGGGCGAGTACGAGGAGGCGAGGAAGAAGAGGGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail