Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4879
Gene name
Locationscaffold_391:15991..18307
Strand+
Gene length (bp)2316
Transcript length (bp)2316
Coding sequence length (bp)2313
Protein length (aa) 771

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01553 Acyltransferase Acyltransferase 4.4E-05 234 293

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7P0|YOL4_SCHPO Uncharacterized acyltransferase C1718.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1718.04 PE=1 SV=1 24 658 3.0E-164
sp|P32784|GPT1_YEAST Glycerol-3-phosphate O-acyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCT1 PE=1 SV=3 9 612 4.0E-153
sp|P36148|GPT2_YEAST Glycerol-3-phosphate O-acyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPT2 PE=1 SV=1 18 609 7.0E-131

GO

GO Term Description Terminal node
GO:0016746 acyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

Domain # Start End Length
1 444 463 19
2 494 516 22
3 531 553 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4879
MSLGEERGRRPPGPGKELYPMVKWKYDLFLYSMGNMVDLFFREVVPRGSWKVPQSGPVLFVAAPHANQFVDAIIL
QRTLRHEAARRVSLLIAQKSVHGFIGWASRQVGSVPVGRAQDAATPATGTIYLPDPVADPTLVRGIGTRFGEGEG
EPQGMLFLPPGKKTSGASVDIAQIIGPEELRIKRPFKGKLAMQQLTGRDDVDDEGRLTHTEVRGPAPGYEGTRFK
VAPHIDQTKVYEAVFARLRNGGCVGIFPEGGSHDRTELLPLKAGVAIMALGALAESPDCGLKIVPVGMNYFHAHK
FRSRAVVEFGTPFEIPSHVVELYRNNRRREAIGQVLDTVYQALSSVTVSAPDYDTLMLVQAARRLYNPTGKKLPL
PVVVELNRRLAMGYERYKDDERITSLSRAVKSYNQQLRYLNLKDHQVQYARMSLLKVLFLIVYRSAKLAVLLAFT
VPGLLLFAPVFAASKVISRRKAKTALAGSTVKIRGHDVMATWKILVALGLAPTLYHAYSIAVVALVWHDRLWGRV
PGWVPLWLVYLGAWPVMIGMTLAALRFGEVGMDIFKSLRPLVLCLLPTSSFNIHKLRVRRAELSVQVTELINELG
PDMFADFDKTRLIPDMTRVEGAGSQAGTAAAAEPQRRPSDSDQWNGEFVCEVESPPSLSRRSTTQSSRRLPRNDS
FSNIGAVGIFSTRPPSRSRSRSRSSSAGGGLGMSGFPLGAFTTLDSAEGLNEATRKIREAMKDRRRRSDKLRVED
DDDERDSEAEGEYEEARKKRV
Coding >Ophio5|4879
ATGTCTCTCGGCGAGGAGCGCGGCAGACGGCCGCCCGGCCCGGGCAAGGAGCTGTATCCCATGGTCAAATGGAAA
TACGACTTGTTCCTCTACAGCATGGGAAACATGGTTGACTTGTTCTTCCGCGAGGTCGTGCCCCGGGGCTCGTGG
AAGGTGCCGCAATCGGGGCCCGTGCTGTTCGTCGCGGCGCCACACGCCAACCAGTTCGTCGACGCCATCATCCTC
CAGCGGACCCTTAGGCACGAGGCCGCCCGGCGCGTGTCGCTCCTCATCGCCCAGAAATCCGTCCACGGCTTCATC
GGTTGGGCTTCGCGCCAGGTTGGCTCCGTGCCCGTCGGCCGGGCCCAGGACGCGGCCACGCCGGCAACCGGTACC
ATCTATCTTCCCGACCCGGTCGCGGACCCTACGCTGGTCCGGGGAATCGGCACCCGCTTCGGCGAGGGCGAGGGC
GAGCCGCAGGGCATGCTGTTCCTCCCGCCCGGCAAGAAGACGTCGGGCGCCAGCGTCGATATCGCCCAGATCATC
GGCCCGGAGGAGTTGCGCATCAAGCGACCATTCAAGGGCAAGCTCGCCATGCAGCAACTGACGGGCCGCGACGAC
GTCGACGACGAGGGTAGGCTGACTCACACCGAGGTCAGGGGCCCCGCGCCCGGCTACGAGGGCACCCGCTTCAAG
GTGGCGCCGCACATCGACCAGACCAAGGTGTACGAGGCCGTCTTCGCCCGGCTGCGCAACGGCGGCTGCGTCGGC
ATCTTTCCCGAGGGCGGCAGCCACGACCGCACCGAGCTGCTGCCGCTCAAGGCGGGCGTCGCCATCATGGCGCTG
GGCGCGCTGGCCGAGTCGCCCGACTGCGGGCTCAAGATTGTGCCGGTTGGCATGAACTACTTTCACGCCCACAAG
TTCCGCTCGCGCGCCGTCGTCGAGTTTGGCACACCGTTCGAGATCCCTTCACACGTGGTGGAACTATATCGCAAC
AACCGGCGACGCGAGGCCATCGGACAGGTGCTCGACACCGTCTACCAGGCCCTGAGCTCGGTGACGGTGTCGGCG
CCCGACTACGACACGCTGATGCTGGTGCAGGCGGCGCGGCGGCTGTACAACCCGACGGGTAAGAAGCTGCCGCTG
CCCGTCGTCGTCGAGCTCAACCGGCGGCTGGCCATGGGCTACGAGCGCTACAAGGACGACGAGCGCATCACGTCG
CTGTCGCGGGCGGTCAAGAGCTACAACCAGCAGCTGCGGTACCTGAACCTCAAGGACCACCAGGTGCAGTATGCG
CGCATGTCGCTGCTCAAGGTGCTCTTTCTCATCGTCTACCGGTCGGCCAAGCTGGCGGTCCTGCTGGCATTTACG
GTGCCGGGCCTGCTGCTCTTCGCTCCCGTCTTCGCCGCTTCCAAGGTCATCAGCCGGCGCAAGGCCAAGACGGCG
CTGGCGGGCTCGACGGTCAAGATTCGCGGGCACGACGTCATGGCGACGTGGAAGATCCTGGTGGCGCTGGGGCTG
GCCCCGACGCTCTACCACGCCTACTCCATCGCCGTCGTGGCCCTGGTGTGGCACGACCGGCTCTGGGGCCGGGTG
CCGGGCTGGGTGCCGCTGTGGCTGGTATACCTGGGCGCGTGGCCCGTCATGATTGGCATGACGCTCGCGGCGCTG
CGCTTCGGCGAGGTGGGCATGGACATTTTCAAGTCGCTACGGCCGCTGGTGCTGTGCCTGCTGCCGACGTCGTCG
TTTAACATACACAAGCTGCGCGTCAGGCGGGCGGAGCTGAGCGTGCAGGTGACGGAACTGATCAACGAGCTCGGG
CCAGACATGTTTGCCGACTTTGACAAGACGCGACTGATTCCGGACATGACGAGGGTCGAGGGTGCCGGTTCGCAG
GCCGGCACGGCGGCTGCGGCTGAACCGCAGAGGCGACCCTCGGACAGCGACCAGTGGAACGGCGAATTCGTGTGC
GAGGTGGAGTCGCCACCGTCTTTGTCGAGGCGCAGCACGACGCAATCGAGCCGCAGGCTACCGAGGAACGACTCG
TTCAGCAACATTGGGGCCGTGGGCATCTTCTCGACGCGGCCGCCGTCACGGTCCAGGAGCCGGTCGCGGTCGAGC
AGCGCCGGGGGCGGGCTCGGGATGAGCGGATTCCCGCTGGGCGCCTTTACCACGCTCGACTCGGCCGAAGGGCTC
AATGAGGCGACGAGGAAGATCCGCGAGGCGATGAAGGATCGGCGTAGGCGGTCGGACAAGCTGCGGGTGGAAGAC
GATGACGACGAGAGGGACAGCGAGGCCGAGGGCGAGTACGAGGAGGCGAGGAAGAAGAGGGTG
Transcript >Ophio5|4879
ATGTCTCTCGGCGAGGAGCGCGGCAGACGGCCGCCCGGCCCGGGCAAGGAGCTGTATCCCATGGTCAAATGGAAA
TACGACTTGTTCCTCTACAGCATGGGAAACATGGTTGACTTGTTCTTCCGCGAGGTCGTGCCCCGGGGCTCGTGG
AAGGTGCCGCAATCGGGGCCCGTGCTGTTCGTCGCGGCGCCACACGCCAACCAGTTCGTCGACGCCATCATCCTC
CAGCGGACCCTTAGGCACGAGGCCGCCCGGCGCGTGTCGCTCCTCATCGCCCAGAAATCCGTCCACGGCTTCATC
GGTTGGGCTTCGCGCCAGGTTGGCTCCGTGCCCGTCGGCCGGGCCCAGGACGCGGCCACGCCGGCAACCGGTACC
ATCTATCTTCCCGACCCGGTCGCGGACCCTACGCTGGTCCGGGGAATCGGCACCCGCTTCGGCGAGGGCGAGGGC
GAGCCGCAGGGCATGCTGTTCCTCCCGCCCGGCAAGAAGACGTCGGGCGCCAGCGTCGATATCGCCCAGATCATC
GGCCCGGAGGAGTTGCGCATCAAGCGACCATTCAAGGGCAAGCTCGCCATGCAGCAACTGACGGGCCGCGACGAC
GTCGACGACGAGGGTAGGCTGACTCACACCGAGGTCAGGGGCCCCGCGCCCGGCTACGAGGGCACCCGCTTCAAG
GTGGCGCCGCACATCGACCAGACCAAGGTGTACGAGGCCGTCTTCGCCCGGCTGCGCAACGGCGGCTGCGTCGGC
ATCTTTCCCGAGGGCGGCAGCCACGACCGCACCGAGCTGCTGCCGCTCAAGGCGGGCGTCGCCATCATGGCGCTG
GGCGCGCTGGCCGAGTCGCCCGACTGCGGGCTCAAGATTGTGCCGGTTGGCATGAACTACTTTCACGCCCACAAG
TTCCGCTCGCGCGCCGTCGTCGAGTTTGGCACACCGTTCGAGATCCCTTCACACGTGGTGGAACTATATCGCAAC
AACCGGCGACGCGAGGCCATCGGACAGGTGCTCGACACCGTCTACCAGGCCCTGAGCTCGGTGACGGTGTCGGCG
CCCGACTACGACACGCTGATGCTGGTGCAGGCGGCGCGGCGGCTGTACAACCCGACGGGTAAGAAGCTGCCGCTG
CCCGTCGTCGTCGAGCTCAACCGGCGGCTGGCCATGGGCTACGAGCGCTACAAGGACGACGAGCGCATCACGTCG
CTGTCGCGGGCGGTCAAGAGCTACAACCAGCAGCTGCGGTACCTGAACCTCAAGGACCACCAGGTGCAGTATGCG
CGCATGTCGCTGCTCAAGGTGCTCTTTCTCATCGTCTACCGGTCGGCCAAGCTGGCGGTCCTGCTGGCATTTACG
GTGCCGGGCCTGCTGCTCTTCGCTCCCGTCTTCGCCGCTTCCAAGGTCATCAGCCGGCGCAAGGCCAAGACGGCG
CTGGCGGGCTCGACGGTCAAGATTCGCGGGCACGACGTCATGGCGACGTGGAAGATCCTGGTGGCGCTGGGGCTG
GCCCCGACGCTCTACCACGCCTACTCCATCGCCGTCGTGGCCCTGGTGTGGCACGACCGGCTCTGGGGCCGGGTG
CCGGGCTGGGTGCCGCTGTGGCTGGTATACCTGGGCGCGTGGCCCGTCATGATTGGCATGACGCTCGCGGCGCTG
CGCTTCGGCGAGGTGGGCATGGACATTTTCAAGTCGCTACGGCCGCTGGTGCTGTGCCTGCTGCCGACGTCGTCG
TTTAACATACACAAGCTGCGCGTCAGGCGGGCGGAGCTGAGCGTGCAGGTGACGGAACTGATCAACGAGCTCGGG
CCAGACATGTTTGCCGACTTTGACAAGACGCGACTGATTCCGGACATGACGAGGGTCGAGGGTGCCGGTTCGCAG
GCCGGCACGGCGGCTGCGGCTGAACCGCAGAGGCGACCCTCGGACAGCGACCAGTGGAACGGCGAATTCGTGTGC
GAGGTGGAGTCGCCACCGTCTTTGTCGAGGCGCAGCACGACGCAATCGAGCCGCAGGCTACCGAGGAACGACTCG
TTCAGCAACATTGGGGCCGTGGGCATCTTCTCGACGCGGCCGCCGTCACGGTCCAGGAGCCGGTCGCGGTCGAGC
AGCGCCGGGGGCGGGCTCGGGATGAGCGGATTCCCGCTGGGCGCCTTTACCACGCTCGACTCGGCCGAAGGGCTC
AATGAGGCGACGAGGAAGATCCGCGAGGCGATGAAGGATCGGCGTAGGCGGTCGGACAAGCTGCGGGTGGAAGAC
GATGACGACGAGAGGGACAGCGAGGCCGAGGGCGAGTACGAGGAGGCGAGGAAGAAGAGGGTGTGA
Gene >Ophio5|4879
ATGTCTCTCGGCGAGGAGCGCGGCAGACGGCCGCCCGGCCCGGGCAAGGAGCTGTATCCCATGGTCAAATGGAAA
TACGACTTGTTCCTCTACAGCATGGGAAACATGGTTGACTTGTTCTTCCGCGAGGTCGTGCCCCGGGGCTCGTGG
AAGGTGCCGCAATCGGGGCCCGTGCTGTTCGTCGCGGCGCCACACGCCAACCAGTTCGTCGACGCCATCATCCTC
CAGCGGACCCTTAGGCACGAGGCCGCCCGGCGCGTGTCGCTCCTCATCGCCCAGAAATCCGTCCACGGCTTCATC
GGTTGGGCTTCGCGCCAGGTTGGCTCCGTGCCCGTCGGCCGGGCCCAGGACGCGGCCACGCCGGCAACCGGTACC
ATCTATCTTCCCGACCCGGTCGCGGACCCTACGCTGGTCCGGGGAATCGGCACCCGCTTCGGCGAGGGCGAGGGC
GAGCCGCAGGGCATGCTGTTCCTCCCGCCCGGCAAGAAGACGTCGGGCGCCAGCGTCGATATCGCCCAGATCATC
GGCCCGGAGGAGTTGCGCATCAAGCGACCATTCAAGGGCAAGCTCGCCATGCAGCAACTGACGGGCCGCGACGAC
GTCGACGACGAGGGTAGGCTGACTCACACCGAGGTCAGGGGCCCCGCGCCCGGCTACGAGGGCACCCGCTTCAAG
GTGGCGCCGCACATCGACCAGACCAAGGTGTACGAGGCCGTCTTCGCCCGGCTGCGCAACGGCGGCTGCGTCGGC
ATCTTTCCCGAGGGCGGCAGCCACGACCGCACCGAGCTGCTGCCGCTCAAGGCGGGCGTCGCCATCATGGCGCTG
GGCGCGCTGGCCGAGTCGCCCGACTGCGGGCTCAAGATTGTGCCGGTTGGCATGAACTACTTTCACGCCCACAAG
TTCCGCTCGCGCGCCGTCGTCGAGTTTGGCACACCGTTCGAGATCCCTTCACACGTGGTGGAACTATATCGCAAC
AACCGGCGACGCGAGGCCATCGGACAGGTGCTCGACACCGTCTACCAGGCCCTGAGCTCGGTGACGGTGTCGGCG
CCCGACTACGACACGCTGATGCTGGTGCAGGCGGCGCGGCGGCTGTACAACCCGACGGGTAAGAAGCTGCCGCTG
CCCGTCGTCGTCGAGCTCAACCGGCGGCTGGCCATGGGCTACGAGCGCTACAAGGACGACGAGCGCATCACGTCG
CTGTCGCGGGCGGTCAAGAGCTACAACCAGCAGCTGCGGTACCTGAACCTCAAGGACCACCAGGTGCAGTATGCG
CGCATGTCGCTGCTCAAGGTGCTCTTTCTCATCGTCTACCGGTCGGCCAAGCTGGCGGTCCTGCTGGCATTTACG
GTGCCGGGCCTGCTGCTCTTCGCTCCCGTCTTCGCCGCTTCCAAGGTCATCAGCCGGCGCAAGGCCAAGACGGCG
CTGGCGGGCTCGACGGTCAAGATTCGCGGGCACGACGTCATGGCGACGTGGAAGATCCTGGTGGCGCTGGGGCTG
GCCCCGACGCTCTACCACGCCTACTCCATCGCCGTCGTGGCCCTGGTGTGGCACGACCGGCTCTGGGGCCGGGTG
CCGGGCTGGGTGCCGCTGTGGCTGGTATACCTGGGCGCGTGGCCCGTCATGATTGGCATGACGCTCGCGGCGCTG
CGCTTCGGCGAGGTGGGCATGGACATTTTCAAGTCGCTACGGCCGCTGGTGCTGTGCCTGCTGCCGACGTCGTCG
TTTAACATACACAAGCTGCGCGTCAGGCGGGCGGAGCTGAGCGTGCAGGTGACGGAACTGATCAACGAGCTCGGG
CCAGACATGTTTGCCGACTTTGACAAGACGCGACTGATTCCGGACATGACGAGGGTCGAGGGTGCCGGTTCGCAG
GCCGGCACGGCGGCTGCGGCTGAACCGCAGAGGCGACCCTCGGACAGCGACCAGTGGAACGGCGAATTCGTGTGC
GAGGTGGAGTCGCCACCGTCTTTGTCGAGGCGCAGCACGACGCAATCGAGCCGCAGGCTACCGAGGAACGACTCG
TTCAGCAACATTGGGGCCGTGGGCATCTTCTCGACGCGGCCGCCGTCACGGTCCAGGAGCCGGTCGCGGTCGAGC
AGCGCCGGGGGCGGGCTCGGGATGAGCGGATTCCCGCTGGGCGCCTTTACCACGCTCGACTCGGCCGAAGGGCTC
AATGAGGCGACGAGGAAGATCCGCGAGGCGATGAAGGATCGGCGTAGGCGGTCGGACAAGCTGCGGGTGGAAGAC
GATGACGACGAGAGGGACAGCGAGGCCGAGGGCGAGTACGAGGAGGCGAGGAAGAAGAGGGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail