Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4867
Gene name
Locationscaffold_390:617..1453
Strand-
Gene length (bp)836
Transcript length (bp)561
Coding sequence length (bp)558
Protein length (aa) 186

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00025 Arf ADP-ribosylation factor family 7.7E-41 16 181
PF00071 Ras Ras family 3.3E-18 26 182
PF08477 Roc Ras of Complex, Roc, domain of DAPkinase 6.9E-15 26 136
PF01926 MMR_HSR1 50S ribosome-binding GTPase 2.3E-06 26 119
PF04670 Gtr1_RagA Gtr1/RagA G protein conserved region 1.7E-05 26 119

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54R04|ARL8_DICDI ADP-ribosylation factor-like protein 8 OS=Dictyostelium discoideum GN=arl8 PE=3 SV=1 23 185 5.0E-67
sp|Q4R4S4|ARL8B_MACFA ADP-ribosylation factor-like protein 8B OS=Macaca fascicularis GN=ARL8B PE=2 SV=1 23 184 9.0E-66
sp|Q66HA6|ARL8B_RAT ADP-ribosylation factor-like protein 8B OS=Rattus norvegicus GN=Arl8b PE=2 SV=1 23 182 1.0E-65
sp|Q9CQW2|ARL8B_MOUSE ADP-ribosylation factor-like protein 8B OS=Mus musculus GN=Arl8b PE=1 SV=1 23 182 1.0E-65
sp|Q9NVJ2|ARL8B_HUMAN ADP-ribosylation factor-like protein 8B OS=Homo sapiens GN=ARL8B PE=1 SV=1 23 182 1.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54R04|ARL8_DICDI ADP-ribosylation factor-like protein 8 OS=Dictyostelium discoideum GN=arl8 PE=3 SV=1 23 185 5.0E-67
sp|Q4R4S4|ARL8B_MACFA ADP-ribosylation factor-like protein 8B OS=Macaca fascicularis GN=ARL8B PE=2 SV=1 23 184 9.0E-66
sp|Q66HA6|ARL8B_RAT ADP-ribosylation factor-like protein 8B OS=Rattus norvegicus GN=Arl8b PE=2 SV=1 23 182 1.0E-65
sp|Q9CQW2|ARL8B_MOUSE ADP-ribosylation factor-like protein 8B OS=Mus musculus GN=Arl8b PE=1 SV=1 23 182 1.0E-65
sp|Q9NVJ2|ARL8B_HUMAN ADP-ribosylation factor-like protein 8B OS=Homo sapiens GN=ARL8B PE=1 SV=1 23 182 1.0E-65
sp|Q6NZW8|AR8BA_DANRE ADP-ribosylation factor-like protein 8B-A OS=Danio rerio GN=arl8ba PE=2 SV=1 23 182 2.0E-65
sp|Q9VHV5|ARL8_DROME ADP-ribosylation factor-like protein 8 OS=Drosophila melanogaster GN=Gie PE=1 SV=1 23 182 3.0E-65
sp|Q96BM9|ARL8A_HUMAN ADP-ribosylation factor-like protein 8A OS=Homo sapiens GN=ARL8A PE=1 SV=1 23 182 4.0E-65
sp|Q5ZKQ8|ARL8A_CHICK ADP-ribosylation factor-like protein 8A OS=Gallus gallus GN=ARL8A PE=2 SV=1 23 182 5.0E-65
sp|Q2KI07|ARL8B_BOVIN ADP-ribosylation factor-like protein 8B OS=Bos taurus GN=ARL8B PE=2 SV=1 23 182 6.0E-65
sp|Q6P8C8|ARL8A_XENTR ADP-ribosylation factor-like protein 8A OS=Xenopus tropicalis GN=arl8a PE=2 SV=1 23 182 1.0E-64
sp|Q5R6E7|ARL8B_PONAB ADP-ribosylation factor-like protein 8B OS=Pongo abelii GN=ARL8B PE=2 SV=1 23 182 3.0E-64
sp|Q8VEH3|ARL8A_MOUSE ADP-ribosylation factor-like protein 8A OS=Mus musculus GN=Arl8a PE=1 SV=1 23 182 7.0E-64
sp|Q94231|ARF11_CAEEL ADP-ribosylation factor 1-like 1 OS=Caenorhabditis elegans GN=arf-1.1 PE=3 SV=3 22 167 4.0E-31
sp|A8ISN6|ARL3_CHLRE ADP-ribosylation factor-like protein 3 OS=Chlamydomonas reinhardtii GN=ARL3 PE=1 SV=2 23 182 1.0E-30
sp|Q58DI9|ARL11_BOVIN ADP-ribosylation factor-like protein 11 OS=Bos taurus GN=ARL11 PE=2 SV=1 23 158 3.0E-30
sp|Q54JJ3|ARFH_DICDI ADP-ribosylation factor H OS=Dictyostelium discoideum GN=arrH PE=3 SV=1 26 159 5.0E-30
sp|P11076|ARF1_YEAST ADP-ribosylation factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARF1 PE=1 SV=3 23 158 8.0E-30
sp|Q54V41|ARFK_DICDI ADP-ribosylation factor K OS=Dictyostelium discoideum GN=arrK PE=3 SV=1 26 159 2.0E-29
sp|Q5BK71|ARL11_RAT ADP-ribosylation factor-like protein 11 OS=Rattus norvegicus GN=Arl11 PE=2 SV=1 17 153 2.0E-29
sp|P22274|ARF_CANAL ADP-ribosylation factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARF1 PE=3 SV=4 23 158 2.0E-29
sp|P19146|ARF2_YEAST ADP-ribosylation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARF2 PE=1 SV=3 23 158 3.0E-29
sp|P51822|ARF1_DAUCA ADP-ribosylation factor 1 OS=Daucus carota GN=ARF1 PE=2 SV=2 23 158 4.0E-29
sp|Q54V47|ARFJ_DICDI ADP-ribosylation factor J OS=Dictyostelium discoideum GN=arrJ PE=3 SV=1 23 159 7.0E-29
sp|P49076|ARF_MAIZE ADP-ribosylation factor OS=Zea mays GN=ARF1 PE=2 SV=2 23 158 1.0E-28
sp|Q06396|ARF1_ORYSJ ADP-ribosylation factor 1 OS=Oryza sativa subsp. japonica GN=Os01g0813400 PE=2 SV=3 23 158 1.0E-28
sp|P51823|ARF2_ORYSJ ADP-ribosylation factor 2 OS=Oryza sativa subsp. japonica GN=ARF PE=2 SV=2 23 158 1.0E-28
sp|Q75A26|ARF_ASHGO ADP-ribosylation factor OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ARF1 PE=3 SV=3 23 158 1.0E-28
sp|O48920|ARF_VIGUN ADP-ribosylation factor OS=Vigna unguiculata GN=ARF PE=2 SV=3 23 158 2.0E-28
sp|P0CM16|ARF_CRYNJ ADP-ribosylation factor OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ARF PE=1 SV=1 23 158 2.0E-28
sp|P0CM17|ARF_CRYNB ADP-ribosylation factor OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ARF PE=3 SV=1 23 158 2.0E-28
sp|P51821|ARF1_CHLRE ADP-ribosylation factor 1 OS=Chlamydomonas reinhardtii GN=ARF1 PE=2 SV=2 23 158 2.0E-28
sp|P36579|ARF1_SCHPO ADP-ribosylation factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arf1 PE=2 SV=2 23 159 2.0E-28
sp|Q6P3A9|ARL11_MOUSE ADP-ribosylation factor-like protein 11 OS=Mus musculus GN=Arl11 PE=2 SV=1 23 167 2.0E-28
sp|P0DH91|ARF2B_ARATH ADP-ribosylation factor 2-B OS=Arabidopsis thaliana GN=ARF2-B PE=2 SV=1 23 158 3.0E-28
sp|Q9LQC8|ARF2A_ARATH ADP-ribosylation factor 2-A OS=Arabidopsis thaliana GN=ARF2-A PE=2 SV=2 23 158 3.0E-28
sp|P36397|ARF1_ARATH ADP-ribosylation factor 1 OS=Arabidopsis thaliana GN=ARF1 PE=1 SV=2 23 158 3.0E-28
sp|O48649|ARF1_SALBA ADP-ribosylation factor 1 OS=Salix bakko GN=ARF1 PE=2 SV=3 23 158 3.0E-28
sp|P51644|ARF4_XENLA ADP-ribosylation factor 4 OS=Xenopus laevis GN=arf4 PE=1 SV=2 23 173 5.0E-28
sp|P34727|ARF_AJECA ADP-ribosylation factor OS=Ajellomyces capsulatus GN=ARF PE=1 SV=3 23 158 8.0E-28
sp|P26991|ARF_GIAIN ADP-ribosylation factor OS=Giardia intestinalis PE=3 SV=3 23 159 8.0E-28
sp|P61210|ARF1_LOCMI ADP-ribosylation factor 1 OS=Locusta migratoria GN=ARF1 PE=2 SV=2 23 158 1.0E-27
sp|P61209|ARF1_DROME ADP-ribosylation factor 1 OS=Drosophila melanogaster GN=Arf79F PE=2 SV=2 23 158 1.0E-27
sp|O23778|ARF1_CATRO ADP-ribosylation factor 1 OS=Catharanthus roseus GN=ARF1 PE=2 SV=3 23 158 1.0E-27
sp|Q61LA8|ARF12_CAEBR ADP-ribosylation factor 1-like 2 OS=Caenorhabditis briggsae GN=arf-1.2 PE=3 SV=3 23 158 1.0E-27
sp|Q10943|ARF12_CAEEL ADP-ribosylation factor 1-like 2 OS=Caenorhabditis elegans GN=arf-1.2 PE=2 SV=2 23 158 1.0E-27
sp|P84079|ARF1_RAT ADP-ribosylation factor 1 OS=Rattus norvegicus GN=Arf1 PE=1 SV=2 23 158 2.0E-27
sp|P84078|ARF1_MOUSE ADP-ribosylation factor 1 OS=Mus musculus GN=Arf1 PE=1 SV=2 23 158 2.0E-27
sp|Q4R5P2|ARF1_MACFA ADP-ribosylation factor 1 OS=Macaca fascicularis GN=ARF1 PE=2 SV=3 23 158 2.0E-27
sp|P84077|ARF1_HUMAN ADP-ribosylation factor 1 OS=Homo sapiens GN=ARF1 PE=1 SV=2 23 158 2.0E-27
sp|P84080|ARF1_BOVIN ADP-ribosylation factor 1 OS=Bos taurus GN=ARF1 PE=1 SV=2 23 158 2.0E-27
sp|P61207|ARF3_TAKRU ADP-ribosylation factor 3 OS=Takifugu rubripes GN=arf3 PE=3 SV=2 23 158 2.0E-27
sp|P61206|ARF3_RAT ADP-ribosylation factor 3 OS=Rattus norvegicus GN=Arf3 PE=2 SV=2 23 158 2.0E-27
sp|Q5R5P7|ARF3_PONAB ADP-ribosylation factor 3 OS=Pongo abelii GN=ARF3 PE=2 SV=3 23 158 2.0E-27
sp|P61205|ARF3_MOUSE ADP-ribosylation factor 3 OS=Mus musculus GN=Arf3 PE=2 SV=2 23 158 2.0E-27
sp|P61204|ARF3_HUMAN ADP-ribosylation factor 3 OS=Homo sapiens GN=ARF3 PE=1 SV=2 23 158 2.0E-27
sp|Q5E9I6|ARF3_BOVIN ADP-ribosylation factor 3 OS=Bos taurus GN=ARF3 PE=2 SV=3 23 158 2.0E-27
sp|P51643|ARF1_XENLA ADP-ribosylation factor 1 OS=Xenopus laevis GN=arf1 PE=2 SV=2 23 158 2.0E-27
sp|P91924|ARF_DUGJA ADP-ribosylation factor OS=Dugesia japonica PE=2 SV=3 23 158 2.0E-27
sp|P51824|ARF1_SOLTU ADP-ribosylation factor 1 OS=Solanum tuberosum PE=2 SV=2 23 158 2.0E-27
sp|P36404|ARL2_HUMAN ADP-ribosylation factor-like protein 2 OS=Homo sapiens GN=ARL2 PE=1 SV=4 13 181 2.0E-27
sp|Q19705|ARL2_CAEEL ADP-ribosylation factor-like protein 2 OS=Caenorhabditis elegans GN=evl-20 PE=2 SV=2 19 162 2.0E-27
sp|Q7RVM2|ARF_NEUCR ADP-ribosylation factor OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU08340 PE=3 SV=3 23 158 3.0E-27
sp|Q06849|ARL2_DROME ADP-ribosylation factor-like protein 2 OS=Drosophila melanogaster GN=Arl2 PE=2 SV=2 20 181 4.0E-27
sp|Q2TA37|ARL2_BOVIN ADP-ribosylation factor-like protein 2 OS=Bos taurus GN=ARL2 PE=1 SV=1 13 181 4.0E-27
sp|P84082|ARF2_RAT ADP-ribosylation factor 2 OS=Rattus norvegicus GN=Arf2 PE=2 SV=1 23 158 4.0E-27
sp|Q8BSL7|ARF2_MOUSE ADP-ribosylation factor 2 OS=Mus musculus GN=Arf2 PE=1 SV=2 23 158 4.0E-27
sp|P84081|ARF2_BOVIN ADP-ribosylation factor 2 OS=Bos taurus GN=ARF2 PE=2 SV=1 23 158 4.0E-27
sp|Q3SZF2|ARF4_BOVIN ADP-ribosylation factor 4 OS=Bos taurus GN=ARF4 PE=2 SV=3 23 173 4.0E-27
sp|P49702|ARF5_CHICK ADP-ribosylation factor 5 OS=Gallus gallus GN=ARF5 PE=2 SV=2 23 173 7.0E-27
sp|O00909|ARF1_DICDI ADP-ribosylation factor 1 OS=Dictyostelium discoideum GN=arfA PE=1 SV=3 23 159 1.0E-26
sp|Q94650|ARF1_PLAFA ADP-ribosylation factor 1 OS=Plasmodium falciparum GN=ARF1 PE=1 SV=3 26 158 1.0E-26
sp|Q7KQL3|ARF1_PLAF7 ADP-ribosylation factor 1 OS=Plasmodium falciparum (isolate 3D7) GN=ARF1 PE=1 SV=1 26 158 1.0E-26
sp|P61208|ARL4C_MOUSE ADP-ribosylation factor-like protein 4C OS=Mus musculus GN=Arl4c PE=2 SV=1 24 152 1.0E-26
sp|P56559|ARL4C_HUMAN ADP-ribosylation factor-like protein 4C OS=Homo sapiens GN=ARL4C PE=1 SV=1 24 152 1.0E-26
sp|Q96361|ARF1_BRARP ADP-ribosylation factor 1 OS=Brassica rapa subsp. pekinensis GN=ARF1 PE=2 SV=3 23 167 2.0E-26
sp|P40940|ARF3_ARATH ADP-ribosylation factor 3 OS=Arabidopsis thaliana GN=ARF3 PE=1 SV=2 23 167 2.0E-26
sp|Q5RCF1|ARF4_PONAB ADP-ribosylation factor 4 OS=Pongo abelii GN=ARF4 PE=2 SV=3 23 173 2.0E-26
sp|P18085|ARF4_HUMAN ADP-ribosylation factor 4 OS=Homo sapiens GN=ARF4 PE=1 SV=3 23 173 2.0E-26
sp|P40945|ARF2_DROME ADP-ribosylation factor 2 OS=Drosophila melanogaster GN=Arf102F PE=2 SV=2 23 158 3.0E-26
sp|P84083|ARF5_RAT ADP-ribosylation factor 5 OS=Rattus norvegicus GN=Arf5 PE=1 SV=2 23 173 4.0E-26
sp|P84084|ARF5_MOUSE ADP-ribosylation factor 5 OS=Mus musculus GN=Arf5 PE=1 SV=2 23 173 4.0E-26
sp|P84085|ARF5_HUMAN ADP-ribosylation factor 5 OS=Homo sapiens GN=ARF5 PE=1 SV=2 23 173 4.0E-26
sp|Q627K4|ARL2_CAEBR ADP-ribosylation factor-like protein 2 OS=Caenorhabditis briggsae GN=evl-20.1 PE=3 SV=1 20 155 4.0E-26
sp|P62332|ARF6_RAT ADP-ribosylation factor 6 OS=Rattus norvegicus GN=Arf6 PE=1 SV=2 23 159 7.0E-26
sp|Q007T5|ARF6_PIG ADP-ribosylation factor 6 OS=Sus scrofa GN=ARF6 PE=2 SV=1 23 159 7.0E-26
sp|P62331|ARF6_MOUSE ADP-ribosylation factor 6 OS=Mus musculus GN=Arf6 PE=1 SV=2 23 159 7.0E-26
sp|P62330|ARF6_HUMAN ADP-ribosylation factor 6 OS=Homo sapiens GN=ARF6 PE=1 SV=2 23 159 7.0E-26
sp|P26990|ARF6_CHICK ADP-ribosylation factor 6 OS=Gallus gallus GN=ARF6 PE=2 SV=3 23 159 8.0E-26
sp|Q969Q4|ARL11_HUMAN ADP-ribosylation factor-like protein 11 OS=Homo sapiens GN=ARL11 PE=1 SV=1 23 180 8.0E-26
sp|Q9Y7Z2|ARF6_SCHPO ADP-ribosylation factor 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arf6 PE=3 SV=1 23 158 8.0E-26
sp|Q25761|ARF1_PLAFO ADP-ribosylation factor 1 OS=Plasmodium falciparum (isolate NF54) GN=ARF1 PE=2 SV=2 26 158 2.0E-25
sp|P40994|ARF3_YEAST ADP-ribosylation factor 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARF3 PE=1 SV=2 21 167 3.0E-25
sp|Q1MTE5|ARL3_DANRE ADP-ribosylation factor-like protein 3 OS=Danio rerio GN=arl3 PE=2 SV=1 11 158 3.0E-25
sp|P40946|ARF3_DROME ADP-ribosylation factor 3 OS=Drosophila melanogaster GN=Arf51F PE=2 SV=3 23 159 3.0E-25
sp|Q9D0J4|ARL2_MOUSE ADP-ribosylation factor-like protein 2 OS=Mus musculus GN=Arl2 PE=1 SV=1 13 167 3.0E-25
sp|B5FYQ0|ARL3_TAEGU ADP-ribosylation factor-like protein 3 OS=Taeniopygia guttata GN=ARL3 PE=2 SV=1 11 158 5.0E-25
sp|O08697|ARL2_RAT ADP-ribosylation factor-like protein 2 OS=Rattus norvegicus GN=Arl2 PE=1 SV=1 13 167 6.0E-25
sp|Q99PE9|ARL4D_MOUSE ADP-ribosylation factor-like protein 4D OS=Mus musculus GN=Arl4d PE=2 SV=2 24 157 8.0E-25
sp|P61751|ARF4_RAT ADP-ribosylation factor 4 OS=Rattus norvegicus GN=Arf4 PE=2 SV=2 23 173 8.0E-25
sp|P61750|ARF4_MOUSE ADP-ribosylation factor 4 OS=Mus musculus GN=Arf4 PE=1 SV=2 23 173 8.0E-25
sp|Q8QHI3|ARL3_XENLA ADP-ribosylation factor-like protein 3 OS=Xenopus laevis GN=arl3 PE=2 SV=1 22 158 1.0E-24
sp|P51645|ARF6_XENLA ADP-ribosylation factor 6 OS=Xenopus laevis GN=arf6 PE=2 SV=2 23 159 1.0E-24
sp|Q9SHU5|ARF4_ARATH Probable ADP-ribosylation factor At2g15310 OS=Arabidopsis thaliana GN=At2g15310 PE=2 SV=3 23 167 2.0E-24
sp|Q20758|ARL1_CAEEL ADP-ribosylation factor-like protein 1 OS=Caenorhabditis elegans GN=arl-1 PE=3 SV=2 21 182 3.0E-24
sp|P25160|ARL1_DROME ADP-ribosylation factor-like protein 1 OS=Drosophila melanogaster GN=Arl1 PE=2 SV=5 23 180 7.0E-24
sp|P40616|ARL1_HUMAN ADP-ribosylation factor-like protein 1 OS=Homo sapiens GN=ARL1 PE=1 SV=1 23 182 1.0E-23
sp|Q2YDM1|ARL1_BOVIN ADP-ribosylation factor-like protein 1 OS=Bos taurus GN=ARL1 PE=2 SV=1 23 182 1.0E-23
sp|P61212|ARL1_RAT ADP-ribosylation factor-like protein 1 OS=Rattus norvegicus GN=Arl1 PE=1 SV=1 23 182 2.0E-23
sp|P61211|ARL1_MOUSE ADP-ribosylation factor-like protein 1 OS=Mus musculus GN=Arl1 PE=1 SV=1 23 182 2.0E-23
sp|P61214|ARL4A_RAT ADP-ribosylation factor-like protein 4A OS=Rattus norvegicus GN=Arl4a PE=2 SV=1 26 146 7.0E-23
sp|P61213|ARL4A_MOUSE ADP-ribosylation factor-like protein 4A OS=Mus musculus GN=Arl4a PE=2 SV=1 26 146 7.0E-23
sp|Q3T0M9|ARL4A_BOVIN ADP-ribosylation factor-like protein 4A OS=Bos taurus GN=ARL4A PE=2 SV=1 26 146 7.0E-23
sp|P40617|ARL4A_HUMAN ADP-ribosylation factor-like protein 4A OS=Homo sapiens GN=ARL4A PE=1 SV=2 26 146 7.0E-23
sp|Q0VC18|ARL4D_BOVIN ADP-ribosylation factor-like protein 4D OS=Bos taurus GN=ARL4D PE=2 SV=1 24 182 1.0E-22
sp|Q5REU3|ARL4D_PONAB ADP-ribosylation factor-like protein 4D OS=Pongo abelii GN=ARL4D PE=2 SV=1 24 156 2.0E-22
sp|P49703|ARL4D_HUMAN ADP-ribosylation factor-like protein 4D OS=Homo sapiens GN=ARL4D PE=1 SV=2 24 156 2.0E-22
sp|Q3SXC5|ARL14_MOUSE ADP-ribosylation factor-like protein 14 OS=Mus musculus GN=Arl14 PE=2 SV=1 13 183 4.0E-22
sp|Q54HK2|ARFF_DICDI ADP-ribosylation factor F OS=Dictyostelium discoideum GN=arrF PE=3 SV=1 26 159 4.0E-22
sp|P38116|ARL1_YEAST ADP-ribosylation factor-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARL1 PE=1 SV=4 23 167 6.0E-22
sp|Q6CB54|SAR1_YARLI Small COPII coat GTPase SAR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SAR1 PE=3 SV=1 11 158 7.0E-22
sp|Q9ZPX1|ARF5_ARATH ADP-ribosylation factor-like protein 2 OS=Arabidopsis thaliana GN=ARL2 PE=2 SV=1 24 155 1.0E-21
sp|P34212|ARL5_CAEEL ADP-ribosylation factor-like protein 5 OS=Caenorhabditis elegans GN=arl-5 PE=3 SV=3 26 157 1.0E-21
sp|Q2HA55|SAR1_CHAGB Small COPII coat GTPase SAR1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SAR1 PE=3 SV=2 11 169 1.0E-21
sp|P0CT17|SAR1_MAGOY Small COPII coat GTPase SAR1 OS=Magnaporthe oryzae (strain Y34) GN=SAR1 PE=2 SV=1 11 169 1.0E-21
sp|P0CT16|SAR1_MAGO7 Small COPII coat GTPase SAR1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SAR1 PE=3 SV=1 11 169 1.0E-21
sp|Q54Y14|SAR1B_DICDI GTP-binding protein Sar1B OS=Dictyostelium discoideum GN=sarB PE=3 SV=1 23 153 2.0E-21
sp|P0C583|SAR1_NEUCR Small COPII coat GTPase sar1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vtr-7 PE=3 SV=1 11 158 2.0E-21
sp|P78976|SAR1_HYPJE Small COPII coat GTPase sar1 OS=Hypocrea jecorina GN=sar1 PE=3 SV=1 11 158 2.0E-21
sp|P52884|SAR2_SOLLC GTP-binding protein SAR2 OS=Solanum lycopersicum GN=SAR2 PE=2 SV=1 7 156 2.0E-21
sp|Q54I24|ARFD_DICDI ADP-ribosylation factor D OS=Dictyostelium discoideum GN=arrD PE=3 SV=2 20 158 3.0E-21
sp|O04266|SAR1A_BRACM GTP-binding protein SAR1A OS=Brassica campestris GN=SAR1A PE=2 SV=1 7 156 5.0E-21
sp|O04834|SAR1A_ARATH GTP-binding protein SAR1A OS=Arabidopsis thaliana GN=SAR1A PE=2 SV=1 11 156 6.0E-21
sp|Q23445|SAR1_CAEEL GTP-binding protein SAR1 OS=Caenorhabditis elegans GN=ZK180.4 PE=3 SV=1 26 158 8.0E-21
sp|P36406|TRI23_HUMAN E3 ubiquitin-protein ligase TRIM23 OS=Homo sapiens GN=TRIM23 PE=1 SV=1 22 162 8.0E-21
sp|P36407|TRI23_RAT E3 ubiquitin-protein ligase TRIM23 OS=Rattus norvegicus GN=Trim23 PE=2 SV=2 22 162 9.0E-21
sp|Q8BGX0|TRI23_MOUSE E3 ubiquitin-protein ligase TRIM23 OS=Mus musculus GN=Trim23 PE=2 SV=1 22 162 9.0E-21
sp|Q5M9P8|ARL6_DANRE ADP-ribosylation factor-like protein 6 OS=Danio rerio GN=arl6 PE=2 SV=1 20 176 1.0E-20
sp|Q5BGB9|SAR1_EMENI Small COPII coat GTPase sar1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sar1 PE=3 SV=1 28 169 3.0E-20
sp|Q55AD9|ARL5_DICDI ADP-ribosylation factor-like protein 5 OS=Dictyostelium discoideum GN=arl5 PE=3 SV=1 23 182 3.0E-20
sp|Q8N8L6|ARL10_HUMAN ADP-ribosylation factor-like protein 10 OS=Homo sapiens GN=ARL10 PE=2 SV=1 23 166 3.0E-20
sp|Q0CUN7|SAR1_ASPTN Small COPII coat GTPase sar1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sar1 PE=3 SV=1 28 169 3.0E-20
sp|P51646|ARL5A_RAT ADP-ribosylation factor-like protein 5A OS=Rattus norvegicus GN=Arl5a PE=2 SV=1 23 162 3.0E-20
sp|Q01475|SAR1_SCHPO Small COPII coat GTPase sar1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sar1 PE=1 SV=1 28 160 3.0E-20
sp|Q9Y689|ARL5A_HUMAN ADP-ribosylation factor-like protein 5A OS=Homo sapiens GN=ARL5A PE=1 SV=1 23 162 3.0E-20
sp|Q8N4G2|ARL14_HUMAN ADP-ribosylation factor-like protein 14 OS=Homo sapiens GN=ARL14 PE=1 SV=2 20 155 4.0E-20
sp|O45379|ARL3_CAEEL ADP-ribosylation factor-like protein 3 OS=Caenorhabditis elegans GN=arl-3 PE=1 SV=1 23 158 5.0E-20
sp|Q877B9|SAR1_ASPOR Small COPII coat GTPase sar1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sar1 PE=3 SV=1 11 169 5.0E-20
sp|P0C951|SAR1_ASPNC Small COPII coat GTPase SAR1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sar1 PE=3 SV=1 28 169 6.0E-20
sp|A1D4D1|SAR1_NEOFI Small COPII coat GTPase sar1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sar1 PE=3 SV=1 11 169 8.0E-20
sp|P36405|ARL3_HUMAN ADP-ribosylation factor-like protein 3 OS=Homo sapiens GN=ARL3 PE=1 SV=2 22 158 9.0E-20
sp|Q01474|SAR1B_ARATH GTP-binding protein SAR1B OS=Arabidopsis thaliana GN=SAR1B PE=1 SV=1 11 156 9.0E-20
sp|A1CRG9|SAR1_ASPCL Small COPII coat GTPase sar1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sar1 PE=3 SV=1 11 169 1.0E-19
sp|Q2KJ96|ARL5A_BOVIN ADP-ribosylation factor-like protein 5A OS=Bos taurus GN=ARL5A PE=2 SV=1 23 162 1.0E-19
sp|Q4WJS7|SAR1_ASPFU Small COPII coat GTPase sar1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sar1 PE=3 SV=1 28 169 1.0E-19
sp|Q2TBW6|ARL3_BOVIN ADP-ribosylation factor-like protein 3 OS=Bos taurus GN=ARL3 PE=2 SV=1 22 158 1.0E-19
sp|Q52NJ4|ARL3_PIG ADP-ribosylation factor-like protein 3 OS=Sus scrofa GN=ARL3 PE=2 SV=1 22 158 1.0E-19
sp|P37996|ARL3_RAT ADP-ribosylation factor-like protein 3 OS=Rattus norvegicus GN=Arl3 PE=1 SV=2 22 158 2.0E-19
sp|O88848|ARL6_MOUSE ADP-ribosylation factor-like protein 6 OS=Mus musculus GN=Arl6 PE=1 SV=1 20 137 2.0E-19
sp|Q9WUL7|ARL3_MOUSE ADP-ribosylation factor-like protein 3 OS=Mus musculus GN=Arl3 PE=1 SV=1 22 158 2.0E-19
sp|Q0IIM2|ARL6_BOVIN ADP-ribosylation factor-like protein 6 OS=Bos taurus GN=ARL6 PE=1 SV=1 20 142 2.0E-19
sp|Q80ZU0|ARL5A_MOUSE ADP-ribosylation factor-like protein 5A OS=Mus musculus GN=Arl5a PE=1 SV=1 23 162 2.0E-19
sp|Q59S78|SAR1_CANAL Small COPII coat GTPase SAR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAR1 PE=3 SV=2 28 160 3.0E-19
sp|O04267|SAR1B_BRACM GTP-binding protein SAR1B OS=Brassica campestris GN=SAR1B PE=2 SV=1 11 156 3.0E-19
sp|A3LTA2|SAR1_PICST Small COPII coat GTPase SAR1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SAR1 PE=3 SV=1 28 160 3.0E-19
sp|Q54UF1|ARL2_DICDI ADP-ribosylation factor-like protein 2 OS=Dictyostelium discoideum GN=arl2 PE=3 SV=1 26 182 3.0E-19
sp|A5E5G3|SAR1_LODEL Small COPII coat GTPase SAR1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SAR1 PE=3 SV=2 28 160 4.0E-19
sp|Q8SQH8|ARF_ENCCU ADP-ribosylation factor OS=Encephalitozoon cuniculi (strain GB-M1) GN=ARF-1 PE=1 SV=3 23 157 4.0E-19
sp|Q09767|ARL_SCHPO ADP-ribosylation factor-like protein alp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp41 PE=3 SV=1 13 180 4.0E-19
sp|P0C950|SAR1_ASPNG Small COPII coat GTPase SAR1 OS=Aspergillus niger GN=sar1 PE=3 SV=1 28 158 5.0E-19
sp|P0CR30|SAR1_CRYNJ Small COPII coat GTPase SAR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SAR1 PE=3 SV=1 28 158 5.0E-19
sp|P0CR31|SAR1_CRYNB Small COPII coat GTPase SAR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SAR1 PE=3 SV=1 28 158 5.0E-19
sp|Q4P0I7|SAR1_USTMA Small COPII coat GTPase SAR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SAR1 PE=3 SV=1 26 158 8.0E-19
sp|Q9H0F7|ARL6_HUMAN ADP-ribosylation factor-like protein 6 OS=Homo sapiens GN=ARL6 PE=1 SV=1 20 137 9.0E-19
sp|Q5R4G5|ARL6_PONAB ADP-ribosylation factor-like protein 6 OS=Pongo abelii GN=ARL6 PE=2 SV=1 20 137 9.0E-19
sp|A5DR82|SAR1_PICGU Small COPII coat GTPase SAR1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SAR1 PE=3 SV=3 28 161 1.0E-18
sp|Q9Y6B6|SAR1B_HUMAN GTP-binding protein SAR1b OS=Homo sapiens GN=SAR1B PE=1 SV=1 26 146 1.0E-18
sp|Q9CQC9|SAR1B_MOUSE GTP-binding protein SAR1b OS=Mus musculus GN=Sar1b PE=1 SV=1 26 146 1.0E-18
sp|Q9QVY3|SAR1B_CRIGR GTP-binding protein SAR1b OS=Cricetulus griseus GN=SAR1B PE=1 SV=1 26 146 1.0E-18
sp|Q3SXY8|AR13B_HUMAN ADP-ribosylation factor-like protein 13B OS=Homo sapiens GN=ARL13B PE=1 SV=1 28 167 1.0E-18
sp|Q5HZY2|SAR1B_RAT GTP-binding protein SAR1b OS=Rattus norvegicus GN=Sar1b PE=2 SV=1 26 146 1.0E-18
sp|Q9D4P0|ARL5B_MOUSE ADP-ribosylation factor-like protein 5B OS=Mus musculus GN=Arl5b PE=2 SV=3 23 162 2.0E-18
sp|Q96KC2|ARL5B_HUMAN ADP-ribosylation factor-like protein 5B OS=Homo sapiens GN=ARL5B PE=1 SV=1 23 162 2.0E-18
sp|Q3T0T7|SAR1B_BOVIN GTP-binding protein SAR1b OS=Bos taurus GN=SAR1B PE=2 SV=1 26 146 2.0E-18
sp|Q5PYH3|SAR1B_PIG GTP-binding protein SAR1b OS=Sus scrofa GN=SAR1B PE=2 SV=1 26 146 2.0E-18
sp|Q0UKC0|SAR1_PHANO Small COPII coat GTPase SAR1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SAR1 PE=3 SV=2 28 169 5.0E-18
sp|Q6BVA7|SAR1_DEBHA Small COPII coat GTPase SAR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SAR1 PE=3 SV=1 28 160 5.0E-18
sp|Q640N2|AR13B_MOUSE ADP-ribosylation factor-like protein 13B OS=Mus musculus GN=Arl13b PE=1 SV=2 28 161 7.0E-18
sp|P20606|SAR1_YEAST Small COPII coat GTPase SAR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAR1 PE=1 SV=1 28 159 1.0E-17
sp|Q559R0|SAR1A_DICDI GTP-binding protein Sar1A OS=Dictyostelium discoideum GN=sarA PE=1 SV=1 26 137 2.0E-17
sp|A8INQ0|ARL13_CHLRE ADP-ribosylation factor-like protein 13B OS=Chlamydomonas reinhardtii GN=ARL13 PE=1 SV=1 26 152 2.0E-17
sp|Q9P4C8|SAR1_PICPG Small COPII coat GTPase SAR1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=SAR1 PE=3 SV=1 28 159 3.0E-17
sp|Q32LJ2|ARFRP_BOVIN ADP-ribosylation factor-related protein 1 OS=Bos taurus GN=ARFRP1 PE=2 SV=1 23 168 3.0E-17
sp|P36536|SAR1A_MOUSE GTP-binding protein SAR1a OS=Mus musculus GN=Sar1a PE=1 SV=1 26 169 4.0E-17
sp|Q18510|ARL6_CAEEL ADP-ribosylation factor-like protein 6 OS=Caenorhabditis elegans GN=arl-6 PE=2 SV=1 23 153 5.0E-17
sp|Q8BGR6|ARL15_MOUSE ADP-ribosylation factor-like protein 15 OS=Mus musculus GN=Arl15 PE=1 SV=1 23 156 6.0E-17
sp|Q6FUZ9|SAR1_CANGA Small COPII coat GTPase SAR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SAR1 PE=3 SV=1 28 159 6.0E-17
sp|Q6P068|ARL5C_MOUSE ADP-ribosylation factor-like protein 5C OS=Mus musculus GN=Arl5c PE=2 SV=1 21 162 7.0E-17
sp|Q6CWR7|SAR1_KLULA Small COPII coat GTPase SAR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SAR1 PE=3 SV=1 28 157 7.0E-17
sp|Q63055|ARFRP_RAT ADP-ribosylation factor-related protein 1 OS=Rattus norvegicus GN=Arfrp1 PE=2 SV=1 23 168 8.0E-17
sp|Q8BXL7|ARFRP_MOUSE ADP-ribosylation factor-related protein 1 OS=Mus musculus GN=Arfrp1 PE=1 SV=2 23 168 8.0E-17
sp|Q9NXU5|ARL15_HUMAN ADP-ribosylation factor-like protein 15 OS=Homo sapiens GN=ARL15 PE=1 SV=1 23 156 9.0E-17
sp|Q9QXJ4|ARL10_MOUSE ADP-ribosylation factor-like protein 10 OS=Mus musculus GN=Arl10 PE=1 SV=2 23 166 9.0E-17
sp|Q5RFN0|ARL15_PONAB ADP-ribosylation factor-like protein 15 OS=Pongo abelii GN=ARL15 PE=2 SV=1 23 156 1.0E-16
sp|Q6T311|ARL9_HUMAN ADP-ribosylation factor-like protein 9 OS=Homo sapiens GN=ARL9 PE=2 SV=1 26 164 1.0E-16
sp|Q5R579|ARFRP_PONAB ADP-ribosylation factor-related protein 1 OS=Pongo abelii GN=ARFRP1 PE=2 SV=1 23 168 1.0E-16
sp|Q13795|ARFRP_HUMAN ADP-ribosylation factor-related protein 1 OS=Homo sapiens GN=ARFRP1 PE=1 SV=1 23 168 1.0E-16
sp|Q755D7|SAR1_ASHGO Small COPII coat GTPase SAR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SAR1 PE=3 SV=1 28 157 1.0E-16
sp|Q5R548|SAR1A_PONAB GTP-binding protein SAR1a OS=Pongo abelii GN=SAR1A PE=2 SV=1 26 146 1.0E-16
sp|Q9NR31|SAR1A_HUMAN GTP-binding protein SAR1a OS=Homo sapiens GN=SAR1A PE=1 SV=1 26 146 1.0E-16
sp|Q60Z38|ARL6_CAEBR ADP-ribosylation factor-like protein 6 OS=Caenorhabditis briggsae GN=arl-6 PE=3 SV=1 23 153 2.0E-16
sp|Q02804|ARL3_YEAST ADP-ribosylation factor-like protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARL3 PE=1 SV=1 1 167 2.0E-16
sp|Q5EA19|ARL15_BOVIN ADP-ribosylation factor-like protein 15 OS=Bos taurus GN=ARL15 PE=2 SV=1 23 156 2.0E-16
sp|Q52NJ3|SAR1A_PIG GTP-binding protein SAR1a OS=Sus scrofa GN=SAR1A PE=2 SV=1 26 146 2.0E-16
sp|Q3T0D7|SAR1A_BOVIN GTP-binding protein SAR1a OS=Bos taurus GN=SAR1A PE=2 SV=1 26 146 2.0E-16
sp|Q8MQT8|SAR1_GIAIN GTP-binding protein Sar1 OS=Giardia intestinalis GN=SAR1 PE=3 SV=1 26 158 3.0E-16
sp|Q09654|TRI23_CAEEL E3 ubiquitin-protein ligase arc-1 OS=Caenorhabditis elegans GN=arc-1 PE=3 SV=3 22 136 9.0E-16
sp|Q1ZXA5|ARLX_DICDI ADP-ribosylation factor-like protein DDB_G0292332 OS=Dictyostelium discoideum GN=DDB_G0292332 PE=3 SV=1 26 147 1.0E-15
sp|Q8JHI3|AR13B_DANRE ADP-ribosylation factor-like protein 13B OS=Danio rerio GN=arl13b PE=1 SV=1 21 161 2.0E-14
sp|Q14088|RB33A_HUMAN Ras-related protein Rab-33A OS=Homo sapiens GN=RAB33A PE=1 SV=2 26 181 3.0E-14
sp|P97950|RB33A_MOUSE Ras-related protein Rab-33A OS=Mus musculus GN=Rab33a PE=2 SV=1 26 181 4.0E-14
sp|Q54K69|RAB7B_DICDI Ras-related protein Rab-7B OS=Dictyostelium discoideum GN=rab7B PE=3 SV=1 24 180 1.0E-13
sp|P34143|RABC_DICDI Ras-related protein RabC OS=Dictyostelium discoideum GN=rabC PE=2 SV=2 26 182 2.0E-13
sp|P11620|YPT1_SCHPO GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt1 PE=1 SV=2 28 174 2.0E-13
sp|Q0WQN4|RAA6B_ARATH Ras-related protein RABA6b OS=Arabidopsis thaliana GN=RABA6B PE=2 SV=2 28 145 3.0E-13
sp|Q39222|RAA1B_ARATH Ras-related protein RABA1b OS=Arabidopsis thaliana GN=RABA1B PE=2 SV=1 26 174 5.0E-13
sp|Q5RCQ6|ARL3_PONAB ADP-ribosylation factor-like protein 3 OS=Pongo abelii GN=ARL3 PE=2 SV=1 22 158 1.0E-12
sp|Q54FK7|RABL_DICDI Ras-related protein RabL OS=Dictyostelium discoideum GN=rabL PE=3 SV=1 24 139 1.0E-12
sp|Q05974|RAB1A_LYMST Ras-related protein Rab-1A OS=Lymnaea stagnalis GN=RAB1A PE=2 SV=1 28 174 1.0E-12
sp|A6NH57|ARL5C_HUMAN Putative ADP-ribosylation factor-like protein 5C OS=Homo sapiens GN=ARL5C PE=3 SV=4 23 185 2.0E-12
sp|F1PTE3|RAB13_CANLF Ras-related protein Rab-13 OS=Canis lupus familiaris GN=RAB13 PE=1 SV=2 28 182 2.0E-12
sp|Q2HJH2|RAB1B_BOVIN Ras-related protein Rab-1B OS=Bos taurus GN=RAB1B PE=2 SV=1 28 174 2.0E-12
sp|P10536|RAB1B_RAT Ras-related protein Rab-1B OS=Rattus norvegicus GN=Rab1b PE=1 SV=1 28 174 3.0E-12
sp|Q40522|RB11D_TOBAC Ras-related protein Rab11D OS=Nicotiana tabacum GN=RAB11D PE=2 SV=1 26 174 3.0E-12
sp|Q5RE13|RAB1B_PONAB Ras-related protein Rab-1B OS=Pongo abelii GN=RAB1B PE=2 SV=1 28 174 3.0E-12
sp|Q9H0U4|RAB1B_HUMAN Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1B PE=1 SV=1 28 174 3.0E-12
sp|Q5U316|RAB35_RAT Ras-related protein Rab-35 OS=Rattus norvegicus GN=Rab35 PE=1 SV=1 28 174 3.0E-12
sp|Q6PHN9|RAB35_MOUSE Ras-related protein Rab-35 OS=Mus musculus GN=Rab35 PE=1 SV=1 28 174 3.0E-12
sp|Q15286|RAB35_HUMAN Ras-related protein Rab-35 OS=Homo sapiens GN=RAB35 PE=1 SV=1 28 174 3.0E-12
sp|Q9D1G1|RAB1B_MOUSE Ras-related protein Rab-1B OS=Mus musculus GN=Rab1b PE=1 SV=1 28 174 4.0E-12
sp|Q4R8X3|RAB1B_MACFA Ras-related protein Rab-1B OS=Macaca fascicularis GN=RAB1B PE=2 SV=1 28 174 4.0E-12
sp|Q40194|RB11D_LOTJA Ras-related protein Rab11D OS=Lotus japonicus GN=RAB11D PE=2 SV=1 28 174 4.0E-12
sp|Q1ZXE7|RABZ_DICDI Ras-related protein RabZ OS=Dictyostelium discoideum GN=rabZ PE=3 SV=2 26 144 5.0E-12
sp|P20791|RAB8B_DICDI Ras-related protein Rab-8B OS=Dictyostelium discoideum GN=rab8B PE=2 SV=1 28 182 5.0E-12
sp|Q52NJ2|RAB1A_PIG Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3 28 174 6.0E-12
sp|Q91YQ1|RAB7L_MOUSE Ras-related protein Rab-7L1 OS=Mus musculus GN=Rab29 PE=1 SV=1 26 182 7.0E-12
sp|P16976|YPTM1_MAIZE GTP-binding protein YPTM1 OS=Zea mays GN=YPTM1 PE=2 SV=2 28 174 7.0E-12
sp|P25766|RLGP1_ORYSJ Ras-related protein RGP1 OS=Oryza sativa subsp. japonica GN=RGP1 PE=2 SV=2 26 174 7.0E-12
sp|Q63481|RAB7L_RAT Ras-related protein Rab-7L1 OS=Rattus norvegicus GN=Rab29 PE=1 SV=1 26 182 7.0E-12
sp|Q5KTJ6|RAB13_MESAU Ras-related protein Rab-13 OS=Mesocricetus auratus GN=RAB13 PE=2 SV=1 28 182 8.0E-12
sp|Q86YS6|RAB43_HUMAN Ras-related protein Rab-43 OS=Homo sapiens GN=RAB43 PE=1 SV=1 28 174 8.0E-12
sp|Q6NYB7|RAB1A_RAT Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3 28 174 8.0E-12
sp|P62821|RAB1A_MOUSE Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3 28 174 8.0E-12
sp|P62820|RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 28 174 8.0E-12
sp|P62822|RAB1A_CANLF Ras-related protein Rab-1A OS=Canis lupus familiaris GN=RAB1A PE=1 SV=3 28 174 8.0E-12
sp|P22125|RAB1_DIPOM Ras-related protein ORAB-1 OS=Diplobatis ommata PE=2 SV=1 28 174 9.0E-12
sp|P28185|RAA1A_ARATH Ras-related protein RABA1a OS=Arabidopsis thaliana GN=RABA1A PE=1 SV=1 28 174 1.0E-11
sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ypt-1 PE=3 SV=1 28 174 1.0E-11
sp|Q7T3A4|RAB13_DANRE Ras-related protein Rab-13 OS=Danio rerio GN=rab13 PE=1 SV=1 28 149 1.0E-11
sp|P35286|RAB13_RAT Ras-related protein Rab-13 OS=Rattus norvegicus GN=Rab13 PE=1 SV=2 28 143 1.0E-11
sp|Q5ZHV1|RB33B_CHICK Ras-related protein Rab-33B OS=Gallus gallus GN=RAB33B PE=2 SV=1 20 186 1.0E-11
sp|P62494|RB11A_RAT Ras-related protein Rab-11A OS=Rattus norvegicus GN=Rab11a PE=1 SV=3 19 181 1.0E-11
sp|P62493|RB11A_RABIT Ras-related protein Rab-11A OS=Oryctolagus cuniculus GN=RAB11A PE=2 SV=3 19 181 1.0E-11
sp|Q5R9M7|RB11A_PONAB Ras-related protein Rab-11A OS=Pongo abelii GN=RAB11A PE=2 SV=3 19 181 1.0E-11
sp|Q52NJ1|RB11A_PIG Ras-related protein Rab-11A OS=Sus scrofa GN=RAB11A PE=2 SV=3 19 181 1.0E-11
sp|P62492|RB11A_MOUSE Ras-related protein Rab-11A OS=Mus musculus GN=Rab11a PE=1 SV=3 19 181 1.0E-11
sp|P62491|RB11A_HUMAN Ras-related protein Rab-11A OS=Homo sapiens GN=RAB11A PE=1 SV=3 19 181 1.0E-11
sp|P62490|RB11A_CANLF Ras-related protein Rab-11A OS=Canis lupus familiaris GN=RAB11A PE=2 SV=3 19 181 1.0E-11
sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT1 OS=Phytophthora infestans GN=YPT1 PE=3 SV=1 28 140 1.0E-11
sp|Q9FK68|RAA1C_ARATH Ras-related protein RABA1c OS=Arabidopsis thaliana GN=RABA1C PE=2 SV=1 26 174 2.0E-11
sp|Q8CG50|RAB43_MOUSE Ras-related protein Rab-43 OS=Mus musculus GN=Rab43 PE=1 SV=1 28 174 2.0E-11
sp|Q53B90|RAB43_RAT Ras-related protein Rab-43 OS=Rattus norvegicus GN=Rab43 PE=2 SV=1 28 174 2.0E-11
sp|O35963|RB33B_MOUSE Ras-related protein Rab-33B OS=Mus musculus GN=Rab33b PE=1 SV=1 20 143 2.0E-11
sp|Q9C9U7|RAA6A_ARATH Ras-related protein RABA6a OS=Arabidopsis thaliana GN=RABA6A PE=2 SV=1 28 145 2.0E-11
sp|Q5R615|RB33B_PONAB Ras-related protein Rab-33B OS=Pongo abelii GN=RAB33B PE=2 SV=1 20 137 2.0E-11
sp|Q9H082|RB33B_HUMAN Ras-related protein Rab-33B OS=Homo sapiens GN=RAB33B PE=1 SV=1 20 137 2.0E-11
sp|Q40520|RB11C_TOBAC Ras-related protein Rab11C OS=Nicotiana tabacum GN=RAB11C PE=2 SV=1 26 174 2.0E-11
sp|Q9SN35|RAA1D_ARATH Ras-related protein RABA1d OS=Arabidopsis thaliana GN=RABA1D PE=2 SV=1 26 174 2.0E-11
sp|Q9DD03|RAB13_MOUSE Ras-related protein Rab-13 OS=Mus musculus GN=Rab13 PE=1 SV=1 28 143 2.0E-11
sp|P51153|RAB13_HUMAN Ras-related protein Rab-13 OS=Homo sapiens GN=RAB13 PE=1 SV=1 28 182 2.0E-11
sp|Q2TA29|RB11A_BOVIN Ras-related protein Rab-11A OS=Bos taurus GN=RAB11A PE=2 SV=3 19 181 2.0E-11
sp|P31584|YPTV1_VOLCA GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1 28 174 2.0E-11
sp|Q6DUB4|RAB7B_PAROT Ras-related protein Rab-7b OS=Paramecium octaurelia GN=Rab7b PE=1 SV=1 26 185 2.0E-11
sp|O24466|RAE1A_ARATH Ras-related protein RABE1a OS=Arabidopsis thaliana GN=RABE1A PE=1 SV=1 28 182 3.0E-11
sp|Q5ZJN2|RB11A_CHICK Ras-related protein Rab-11A OS=Gallus gallus GN=RAB11A PE=2 SV=1 26 181 3.0E-11
sp|Q39572|YPTC6_CHLRE Ras-related protein YPTC6 OS=Chlamydomonas reinhardtii GN=YPTC6 PE=3 SV=1 26 178 3.0E-11
sp|Q39571|YPTC1_CHLRE GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1 28 174 4.0E-11
sp|Q58DS5|RAB13_BOVIN Ras-related protein Rab-13 OS=Bos taurus GN=RAB13 PE=1 SV=1 28 182 4.0E-11
sp|P22129|RB11B_DIPOM Ras-related protein Rab-11B OS=Diplobatis ommata PE=2 SV=1 19 145 4.0E-11
sp|Q95UJ0|RAB7A_PAROT Ras-related protein Rab-7a OS=Paramecium octaurelia GN=Rab7a PE=1 SV=2 26 185 4.0E-11
sp|Q55E31|RB32B_DICDI Ras-related protein Rab-32B OS=Dictyostelium discoideum GN=rab32B PE=3 SV=1 26 182 5.0E-11
sp|P46638|RB11B_MOUSE Ras-related protein Rab-11B OS=Mus musculus GN=Rab11b PE=1 SV=3 19 145 5.0E-11
sp|Q9LNW1|RAA2B_ARATH Ras-related protein RABA2b OS=Arabidopsis thaliana GN=RABA2B PE=2 SV=2 26 181 5.0E-11
sp|O35509|RB11B_RAT Ras-related protein Rab-11B OS=Rattus norvegicus GN=Rab11b PE=1 SV=4 19 145 6.0E-11
sp|Q15907|RB11B_HUMAN Ras-related protein Rab-11B OS=Homo sapiens GN=RAB11B PE=1 SV=4 19 145 6.0E-11
sp|Q3MHP2|RB11B_BOVIN Ras-related protein Rab-11B OS=Bos taurus GN=RAB11B PE=2 SV=3 19 145 6.0E-11
sp|Q06AU7|RAB1B_PIG Ras-related protein Rab-1B OS=Sus scrofa GN=RAB1B PE=2 SV=1 28 174 6.0E-11
sp|P70550|RAB8B_RAT Ras-related protein Rab-8B OS=Rattus norvegicus GN=Rab8b PE=1 SV=1 28 174 6.0E-11
sp|P61028|RAB8B_MOUSE Ras-related protein Rab-8B OS=Mus musculus GN=Rab8b PE=1 SV=1 28 174 6.0E-11
sp|Q5REC9|RAB8B_PONAB Ras-related protein Rab-8B OS=Pongo abelii GN=RAB8B PE=2 SV=1 28 174 6.0E-11
sp|Q92928|RAB1C_HUMAN Putative Ras-related protein Rab-1C OS=Homo sapiens GN=RAB1C PE=5 SV=2 28 174 7.0E-11
sp|P28186|RAE1C_ARATH Ras-related protein RABE1c OS=Arabidopsis thaliana GN=RABE1C PE=1 SV=1 28 176 7.0E-11
sp|Q39433|RB1BV_BETVU Ras-related protein RAB1BV OS=Beta vulgaris GN=RAB1BV PE=2 SV=1 28 176 8.0E-11
sp|P34139|RAB1A_DICDI Ras-related protein Rab-1A OS=Dictyostelium discoideum GN=rab1A PE=2 SV=2 28 174 1.0E-10
sp|Q5R7A4|RAB7L_PONAB Ras-related protein Rab-7L1 OS=Pongo abelii GN=RAB29 PE=2 SV=1 26 182 1.0E-10
sp|O14966|RAB7L_HUMAN Ras-related protein Rab-7L1 OS=Homo sapiens GN=RAB29 PE=1 SV=1 26 182 1.0E-10
sp|P20790|RAB8A_DICDI Ras-related protein Rab-8A OS=Dictyostelium discoideum GN=rab8A PE=3 SV=1 28 182 1.0E-10
sp|Q96283|RAA2C_ARATH Ras-related protein RABA2c OS=Arabidopsis thaliana GN=RABA2C PE=2 SV=4 26 181 1.0E-10
sp|P07560|SEC4_YEAST Ras-related protein SEC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC4 PE=1 SV=1 24 182 1.0E-10
sp|P40393|RIC2_ORYSJ Ras-related protein RIC2 OS=Oryza sativa subsp. japonica GN=RIC2 PE=2 SV=2 26 174 1.0E-10
sp|P41924|RYL1_YARLI Ras-like GTP-binding protein RYL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL1 PE=3 SV=1 28 140 1.0E-10
sp|Q5U1Y1|RAB34_RAT Ras-related protein Rab-34 OS=Rattus norvegicus GN=Rab34 PE=2 SV=1 26 145 1.0E-10
sp|Q9LK99|RAA1G_ARATH Ras-related protein RABA1g OS=Arabidopsis thaliana GN=RABA1G PE=2 SV=1 26 174 1.0E-10
sp|P36412|RB11A_DICDI Ras-related protein Rab-11A OS=Dictyostelium discoideum GN=rab11A PE=1 SV=1 26 145 1.0E-10
sp|Q40193|RB11C_LOTJA Ras-related protein Rab11C OS=Lotus japonicus GN=RAB11C PE=2 SV=1 26 181 1.0E-10
sp|Q9FE79|RAA4C_ARATH Ras-related protein RABA4c OS=Arabidopsis thaliana GN=RABA4C PE=2 SV=1 26 137 1.0E-10
sp|Q9SMQ6|RAA4B_ARATH Ras-related protein RABA4b OS=Arabidopsis thaliana GN=RABA4B PE=1 SV=1 26 143 1.0E-10
sp|P36861|YPTV2_VOLCA GTP-binding protein yptV2 OS=Volvox carteri GN=YPTV2 PE=3 SV=1 28 174 1.0E-10
sp|Q39434|RB2BV_BETVU Ras-related protein Rab2BV OS=Beta vulgaris GN=RAB2BV PE=2 SV=1 26 176 1.0E-10
sp|Q94986|RAB3_CAEEL Ras-related protein Rab-3 OS=Caenorhabditis elegans GN=rab-3 PE=2 SV=1 28 182 1.0E-10
sp|Q9LH50|RAA4D_ARATH Ras-related protein RABA4d OS=Arabidopsis thaliana GN=RABA4D PE=1 SV=1 26 137 1.0E-10
sp|P01123|YPT1_YEAST GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT1 PE=1 SV=2 28 140 1.0E-10
sp|Q05737|YPTM2_MAIZE GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1 28 137 2.0E-10
sp|Q64008|RAB34_MOUSE Ras-related protein Rab-34 OS=Mus musculus GN=Rab34 PE=1 SV=2 26 145 2.0E-10
sp|Q40521|RB11B_TOBAC Ras-related protein Rab11B OS=Nicotiana tabacum GN=RAB11B PE=2 SV=1 28 174 2.0E-10
sp|Q9TVU5|RAB1_THEPA Ras-related protein Rab-1 OS=Theileria parva GN=rab1 PE=1 SV=1 26 182 2.0E-10
sp|Q9FJH0|RAA1F_ARATH Ras-related protein RABA1f OS=Arabidopsis thaliana GN=RABA1F PE=2 SV=1 26 174 2.0E-10
sp|O42819|SEC4_CANGA Ras-related protein SEC4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC4 PE=3 SV=1 24 141 2.0E-10
sp|P22128|RAB8_DIPOM Ras-related protein Rab-8 OS=Diplobatis ommata PE=2 SV=1 28 143 2.0E-10
sp|Q1PEX3|RAA1H_ARATH Ras-related protein RABA1h OS=Arabidopsis thaliana GN=RABA1H PE=2 SV=1 26 148 2.0E-10
sp|Q92930|RAB8B_HUMAN Ras-related protein Rab-8B OS=Homo sapiens GN=RAB8B PE=1 SV=2 28 143 2.0E-10
sp|Q2HJI8|RAB8B_BOVIN Ras-related protein Rab-8B OS=Bos taurus GN=RAB8B PE=2 SV=1 28 143 2.0E-10
sp|Q54RX9|RAB5B_DICDI Putative ras-related protein Rab-5B OS=Dictyostelium discoideum GN=rab5B PE=5 SV=1 28 146 2.0E-10
sp|P34140|RAB1B_DICDI Ras-related protein Rab-1B OS=Dictyostelium discoideum GN=rab1B PE=2 SV=2 28 144 2.0E-10
sp|Q06AU4|RAB34_PIG Ras-related protein Rab-34 OS=Sus scrofa GN=RAB34 PE=2 SV=1 26 137 2.0E-10
sp|Q40723|RLGP2_ORYSJ Ras-related protein RGP2 OS=Oryza sativa subsp. japonica GN=RGP2 PE=2 SV=2 28 181 3.0E-10
sp|Q9FJN8|RAA4A_ARATH Ras-related protein RABA4a OS=Arabidopsis thaliana GN=RABA4A PE=1 SV=1 26 176 3.0E-10
sp|P28188|RAD2A_ARATH Ras-related protein RABD2a OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3 28 174 3.0E-10
sp|P34141|RABA_DICDI Ras-related protein RabA OS=Dictyostelium discoideum GN=rabA PE=2 SV=2 28 182 3.0E-10
sp|P52885|SAR1_TOBAC GTP-binding protein SAR1 OS=Nicotiana tabacum GN=SAR1 PE=2 SV=1 7 133 4.0E-10
sp|P40392|RIC1_ORYSJ Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2 28 174 4.0E-10
sp|P36864|YPTV5_VOLCA GTP-binding protein yptV5 OS=Volvox carteri GN=YPTV5 PE=3 SV=1 24 186 4.0E-10
sp|Q9BZG1|RAB34_HUMAN Ras-related protein Rab-34 OS=Homo sapiens GN=RAB34 PE=1 SV=1 26 137 4.0E-10
sp|Q40191|RB11A_LOTJA Ras-related protein Rab11A OS=Lotus japonicus GN=RAB11A PE=2 SV=1 26 176 4.0E-10
sp|Q9SMR4|RAH1C_ARATH Ras-related protein RABH1c OS=Arabidopsis thaliana GN=RABH1C PE=1 SV=1 28 178 5.0E-10
sp|Q40195|RB11E_LOTJA Ras-related protein Rab11E OS=Lotus japonicus GN=RAB11E PE=2 SV=1 28 174 5.0E-10
sp|Q9FIF9|RAA2D_ARATH Ras-related protein RABA2d OS=Arabidopsis thaliana GN=RABA2D PE=2 SV=1 26 178 6.0E-10
sp|Q54NU2|RAB1D_DICDI Ras-related protein Rab-1D OS=Dictyostelium discoideum GN=rab1D PE=1 SV=1 26 174 6.0E-10
sp|Q8CAM5|RAB36_MOUSE Ras-related protein Rab-36 OS=Mus musculus GN=Rab36 PE=1 SV=1 2 137 7.0E-10
sp|P39110|CIN4_YEAST GTP-binding protein CIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIN4 PE=1 SV=1 20 137 8.0E-10
sp|Q40523|RB11A_TOBAC Ras-related protein Rab11A OS=Nicotiana tabacum GN=RAB11A PE=2 SV=1 28 176 8.0E-10
sp|Q9FPJ4|RAD2B_ARATH Ras-related protein RABD2b OS=Arabidopsis thaliana GN=RABD2B PE=2 SV=1 28 174 8.0E-10
sp|Q9WTL2|RAB25_MOUSE Ras-related protein Rab-25 OS=Mus musculus GN=Rab25 PE=1 SV=2 26 182 9.0E-10
sp|Q9SRS5|RAA5B_ARATH Ras-related protein RABA5b OS=Arabidopsis thaliana GN=RABA5B PE=2 SV=1 26 145 1.0E-09
sp|Q01111|YPT3_NICPL Ras-related protein YPT3 OS=Nicotiana plumbaginifolia GN=YPT3 PE=2 SV=1 28 174 1.0E-09
sp|P25228|RAB3_DROME Ras-related protein Rab-3 OS=Drosophila melanogaster GN=Rab3 PE=1 SV=1 28 181 1.0E-09
sp|O95716|RAB3D_HUMAN Ras-related protein Rab-3D OS=Homo sapiens GN=RAB3D PE=1 SV=1 28 181 1.0E-09
sp|Q4UB16|RAB1_THEAN Ras-related protein Rab-1 OS=Theileria annulata GN=rab1 PE=3 SV=1 26 182 1.0E-09
sp|Q9SEH3|RAD2C_ARATH Ras-related protein RABD2c OS=Arabidopsis thaliana GN=RABD2C PE=2 SV=1 28 174 1.0E-09
sp|Q08DE8|RAB7B_BOVIN Ras-related protein Rab-7b OS=Bos taurus GN=RAB7B PE=2 SV=1 20 186 1.0E-09
sp|P35292|RAB17_MOUSE Ras-related protein Rab-17 OS=Mus musculus GN=Rab17 PE=1 SV=1 28 137 2.0E-09
sp|P17609|YPT2_SCHPO GTP-binding protein ypt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt2 PE=3 SV=1 28 153 2.0E-09
sp|P41925|RYL2_YARLI Ras-like GTP-binding protein RYL2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL2 PE=3 SV=2 21 181 2.0E-09
sp|Q58DW6|RAB25_BOVIN Ras-related protein Rab-25 OS=Bos taurus GN=RAB25 PE=2 SV=1 24 143 2.0E-09
sp|O04486|RAA2A_ARATH Ras-related protein RABA2a OS=Arabidopsis thaliana GN=RABA2A PE=2 SV=1 26 137 2.0E-09
sp|Q923S9|RAB30_MOUSE Ras-related protein Rab-30 OS=Mus musculus GN=Rab30 PE=1 SV=1 26 176 2.0E-09
sp|Q15771|RAB30_HUMAN Ras-related protein Rab-30 OS=Homo sapiens GN=RAB30 PE=1 SV=2 26 176 2.0E-09
sp|Q17QB7|RAB30_BOVIN Ras-related protein Rab-30 OS=Bos taurus GN=RAB30 PE=2 SV=1 26 176 2.0E-09
sp|Q5H913|AR13A_HUMAN ADP-ribosylation factor-like protein 13A OS=Homo sapiens GN=ARL13A PE=2 SV=2 11 183 2.0E-09
sp|P63012|RAB3A_RAT Ras-related protein Rab-3A OS=Rattus norvegicus GN=Rab3a PE=1 SV=1 26 181 2.0E-09
sp|Q06AU3|RAB3A_PIG Ras-related protein Rab-3A OS=Sus scrofa GN=RAB3A PE=2 SV=1 26 181 2.0E-09
sp|P63011|RAB3A_MOUSE Ras-related protein Rab-3A OS=Mus musculus GN=Rab3a PE=1 SV=1 26 181 2.0E-09
sp|Q9S810|RAA1I_ARATH Ras-related protein RABA1i OS=Arabidopsis thaliana GN=RABA1I PE=2 SV=1 26 145 2.0E-09
sp|Q9UL25|RAB21_HUMAN Ras-related protein Rab-21 OS=Homo sapiens GN=RAB21 PE=1 SV=3 20 182 2.0E-09
sp|Q4R4R9|RAB3A_MACFA Ras-related protein Rab-3A OS=Macaca fascicularis GN=RAB3A PE=2 SV=1 26 181 2.0E-09
sp|P20336|RAB3A_HUMAN Ras-related protein Rab-3A OS=Homo sapiens GN=RAB3A PE=1 SV=1 26 181 2.0E-09
sp|P11023|RAB3A_BOVIN Ras-related protein Rab-3A OS=Bos taurus GN=RAB3A PE=1 SV=3 26 181 2.0E-09
sp|Q40787|RAB7_CENCI Ras-related protein Rab7 OS=Cenchrus ciliaris PE=2 SV=1 16 184 2.0E-09
sp|E2RQ15|RAB25_CANLF Ras-related protein Rab-25 OS=Canis lupus familiaris GN=RAB25 PE=3 SV=1 24 145 2.0E-09
sp|P35276|RAB3D_MOUSE Ras-related protein Rab-3D OS=Mus musculus GN=Rab3d PE=1 SV=1 28 181 3.0E-09
sp|P55745|RAB21_CANLF Ras-related protein Rab-21 OS=Canis lupus familiaris GN=RAB21 PE=3 SV=3 20 182 3.0E-09
sp|P57735|RAB25_HUMAN Ras-related protein Rab-25 OS=Homo sapiens GN=RAB25 PE=1 SV=2 24 143 3.0E-09
sp|O76173|RAB1C_DICDI Ras-related protein Rab-1C OS=Dictyostelium discoideum GN=Rab1C PE=2 SV=1 22 185 3.0E-09
sp|P35280|RAB8A_RAT Ras-related protein Rab-8A OS=Rattus norvegicus GN=Rab8a PE=1 SV=2 28 143 3.0E-09
sp|P55258|RAB8A_MOUSE Ras-related protein Rab-8A OS=Mus musculus GN=Rab8a PE=1 SV=2 28 143 3.0E-09
sp|Q63942|RAB3D_RAT GTP-binding protein Rab-3D OS=Rattus norvegicus GN=Rab3d PE=1 SV=2 28 181 3.0E-09
sp|Q9FGK5|RAA5A_ARATH Ras-related protein RABA5a OS=Arabidopsis thaliana GN=RABA5A PE=2 SV=1 26 145 3.0E-09
sp|P91580|RAB33_CIOIN Putative Ras-related protein Rab-33 OS=Ciona intestinalis GN=COS41.2 PE=3 SV=1 26 144 3.0E-09
sp|Q5R4A3|RAB8A_PONAB Ras-related protein Rab-8A OS=Pongo abelii GN=RAB8A PE=2 SV=1 28 143 4.0E-09
sp|Q39573|YPTC5_CHLRE GTP-binding protein YPTC5 OS=Chlamydomonas reinhardtii GN=YPTC5 PE=3 SV=1 24 186 4.0E-09
sp|A4FV54|RAB8A_BOVIN Ras-related protein Rab-8A OS=Bos taurus GN=RAB8A PE=2 SV=1 28 143 4.0E-09
sp|Q4R5P1|RAB8A_MACFA Ras-related protein Rab-8A OS=Macaca fascicularis GN=RAB8A PE=2 SV=1 28 143 4.0E-09
sp|P61006|RAB8A_HUMAN Ras-related protein Rab-8A OS=Homo sapiens GN=RAB8A PE=1 SV=1 28 143 4.0E-09
sp|P61007|RAB8A_CANLF Ras-related protein Rab-8A OS=Canis lupus familiaris GN=RAB8A PE=2 SV=1 28 143 4.0E-09
sp|Q5M7U5|RAB19_RAT Ras-related protein Rab-19 OS=Rattus norvegicus GN=Rab19 PE=2 SV=1 26 182 5.0E-09
sp|P0CY30|SEC4_CANAX Ras-related protein SEC4 OS=Candida albicans GN=SEC4 PE=3 SV=1 17 145 5.0E-09
sp|C4YL11|SEC4_CANAW Ras-related protein SEC4 OS=Candida albicans (strain WO-1) GN=SEC4 PE=3 SV=1 17 145 5.0E-09
sp|P0CY31|SEC4_CANAL Ras-related protein SEC4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC4 PE=3 SV=1 17 145 5.0E-09
sp|H2L0N8|ARL13_CAEEL ADP-ribosylation factor-like protein 13B OS=Caenorhabditis elegans GN=arl-13 PE=1 SV=1 23 136 5.0E-09
sp|Q5ZIT5|RAB10_CHICK Ras-related protein Rab-10 OS=Gallus gallus GN=RAB10 PE=2 SV=1 28 140 6.0E-09
sp|O49513|RAA1E_ARATH Ras-related protein RABA1e OS=Arabidopsis thaliana GN=RABA1E PE=2 SV=1 28 174 6.0E-09
sp|P35294|RAB19_MOUSE Ras-related protein Rab-19 OS=Mus musculus GN=Rab19 PE=1 SV=3 26 182 6.0E-09
sp|Q9SIP0|RAA5D_ARATH Ras-related protein RABA5d OS=Arabidopsis thaliana GN=RABA5D PE=1 SV=1 26 145 6.0E-09
sp|P51152|RAB12_CANLF Ras-related protein Rab-12 (Fragment) OS=Canis lupus familiaris GN=RAB12 PE=2 SV=1 22 181 7.0E-09
sp|Q54FK5|RABN1_DICDI Ras-related protein RabN1 OS=Dictyostelium discoideum GN=rabN1 PE=3 SV=1 23 184 7.0E-09
sp|Q9SN68|RAF2B_ARATH Ras-related protein RABF2b OS=Arabidopsis thaliana GN=RABF2B PE=1 SV=1 14 176 7.0E-09
sp|Q17R06|RAB21_BOVIN Ras-related protein Rab-21 OS=Bos taurus GN=RAB21 PE=2 SV=1 20 182 8.0E-09
sp|P46629|RAB25_RABIT Ras-related protein Rab-25 OS=Oryctolagus cuniculus GN=RAB25 PE=2 SV=1 24 143 8.0E-09
sp|A4D1S5|RAB19_HUMAN Ras-related protein Rab-19 OS=Homo sapiens GN=RAB19 PE=2 SV=2 26 182 8.0E-09
sp|Q54GY8|RAB18_DICDI Ras-related protein Rab-18 OS=Dictyostelium discoideum GN=rab18 PE=3 SV=1 22 136 1.0E-08
sp|P19892|RAA5E_ARATH Ras-related protein RABA5e OS=Arabidopsis thaliana GN=RABA5E PE=2 SV=1 26 145 1.0E-08
sp|P35283|RAB12_MOUSE Ras-related protein Rab-12 OS=Mus musculus GN=Rab12 PE=1 SV=3 22 181 1.0E-08
sp|P28187|RAA5C_ARATH Ras-related protein RABA5c OS=Arabidopsis thaliana GN=RABA5C PE=1 SV=1 26 145 1.0E-08
sp|P35284|RAB12_RAT Ras-related protein Rab-12 OS=Rattus norvegicus GN=Rab12 PE=1 SV=2 22 181 1.0E-08
sp|Q9H0T7|RAB17_HUMAN Ras-related protein Rab-17 OS=Homo sapiens GN=RAB17 PE=1 SV=2 26 143 1.0E-08
sp|Q6IQ22|RAB12_HUMAN Ras-related protein Rab-12 OS=Homo sapiens GN=RAB12 PE=1 SV=3 22 181 1.0E-08
sp|Q550H6|RB11C_DICDI Ras-related protein Rab-11C OS=Dictyostelium discoideum GN=rab11C PE=1 SV=1 26 137 2.0E-08
sp|A5WW21|RASEF_DANRE Ras and EF-hand domain-containing protein OS=Danio rerio GN=rasef PE=2 SV=1 28 137 2.0E-08
sp|O95755|RAB36_HUMAN Ras-related protein Rab-36 OS=Homo sapiens GN=RAB36 PE=2 SV=2 26 137 3.0E-08
sp|P31582|RAF2A_ARATH Ras-related protein RABF2a OS=Arabidopsis thaliana GN=RABF2A PE=1 SV=1 19 145 3.0E-08
sp|Q9C820|RAG3D_ARATH Ras-related protein RABG3d OS=Arabidopsis thaliana GN=RABG3D PE=2 SV=1 18 184 3.0E-08
sp|O94655|YPT7_SCHPO GTP-binding protein ypt7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt7 PE=3 SV=1 24 184 3.0E-08
sp|P24409|RAB10_CANLF Ras-related protein Rab-10 OS=Canis lupus familiaris GN=RAB10 PE=1 SV=1 28 140 3.0E-08
sp|Q9LW76|RAG3C_ARATH Ras-related protein RABG3c OS=Arabidopsis thaliana GN=RABG3C PE=2 SV=1 16 184 3.0E-08
sp|Q5R5U1|RAB10_PONAB Ras-related protein Rab-10 OS=Pongo abelii GN=RAB10 PE=2 SV=1 28 140 3.0E-08
sp|P61027|RAB10_MOUSE Ras-related protein Rab-10 OS=Mus musculus GN=Rab10 PE=1 SV=1 28 140 3.0E-08
sp|P61026|RAB10_HUMAN Ras-related protein Rab-10 OS=Homo sapiens GN=RAB10 PE=1 SV=1 28 140 3.0E-08
sp|P29687|RAB5_TOBAC Ras-related protein Rab5 OS=Nicotiana tabacum GN=RAB5 PE=2 SV=1 22 145 4.0E-08
sp|Q54QR3|RB32A_DICDI Ras-related protein Rab-32A OS=Dictyostelium discoideum GN=rab32A PE=1 SV=1 26 181 4.0E-08
sp|P22127|RAB10_DIPOM Ras-related protein Rab-10 OS=Diplobatis ommata PE=2 SV=1 28 140 4.0E-08
sp|O23657|RABC1_ARATH Ras-related protein RABC1 OS=Arabidopsis thaliana GN=RABC1 PE=1 SV=1 26 181 4.0E-08
sp|Q948K8|RAG3A_ARATH Ras-related protein RABG3a OS=Arabidopsis thaliana GN=RABG3A PE=2 SV=1 16 137 4.0E-08
sp|P87027|SPG1_SCHPO Septum-promoting GTP-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spg1 PE=1 SV=1 24 140 4.0E-08
sp|P17610|YPT3_SCHPO GTP-binding protein ypt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt3 PE=1 SV=1 28 145 4.0E-08
sp|P23640|RB27A_RAT Ras-related protein Rab-27A OS=Rattus norvegicus GN=Rab27a PE=1 SV=1 29 181 4.0E-08
sp|P38146|YPT10_YEAST GTP-binding protein YPT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT10 PE=1 SV=2 24 137 4.0E-08
sp|Q1HE58|RB27A_CANLF Ras-related protein Rab-27A OS=Canis lupus familiaris GN=RAB27A PE=2 SV=1 29 181 4.0E-08
sp|Q5F470|RAB8A_CHICK Ras-related protein Rab-8A OS=Gallus gallus GN=RAB8A PE=2 SV=1 28 143 4.0E-08
sp|Q32NQ0|RAB19_XENLA Ras-related protein Rab-19 OS=Xenopus laevis GN=rab19 PE=2 SV=1 26 182 4.0E-08
sp|Q9LNK1|RABA3_ARATH Ras-related protein RABA3 OS=Arabidopsis thaliana GN=RABA3 PE=2 SV=1 26 137 5.0E-08
sp|P51996|YPT32_YEAST GTP-binding protein YPT32/YPT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT32 PE=1 SV=3 26 145 5.0E-08
sp|Q9CZT8|RAB3B_MOUSE Ras-related protein Rab-3B OS=Mus musculus GN=Rab3b PE=1 SV=1 28 137 5.0E-08
sp|Q5KTJ7|RAB3B_MESAU Ras-related protein Rab-3B OS=Mesocricetus auratus GN=RAB3B PE=2 SV=1 28 137 5.0E-08
sp|P20337|RAB3B_HUMAN Ras-related protein Rab-3B OS=Homo sapiens GN=RAB3B PE=1 SV=2 28 137 5.0E-08
sp|Q7Z6P3|RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens GN=RAB44 PE=1 SV=3 26 144 5.0E-08
sp|P10948|RAB3B_BOVIN Ras-related protein Rab-3B OS=Bos taurus GN=RAB3B PE=2 SV=1 28 137 5.0E-08
sp|Q63941|RAB3B_RAT Ras-related protein Rab-3B OS=Rattus norvegicus GN=Rab3b PE=1 SV=2 28 137 5.0E-08
sp|Q9LV79|RAH1A_ARATH Ras-related protein RABH1a OS=Arabidopsis thaliana GN=RABH1A PE=2 SV=1 28 145 6.0E-08
sp|Q9ERI2|RB27A_MOUSE Ras-related protein Rab-27A OS=Mus musculus GN=Rab27a PE=1 SV=1 29 181 6.0E-08
sp|Q6AXT5|RAB21_RAT Ras-related protein Rab-21 OS=Rattus norvegicus GN=Rab21 PE=2 SV=1 26 182 6.0E-08
sp|P35282|RAB21_MOUSE Ras-related protein Rab-21 OS=Mus musculus GN=Rab21 PE=1 SV=4 26 182 6.0E-08
sp|Q9HDY0|YPT71_SCHPO GTP-binding protein ypt71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt71 PE=3 SV=1 24 184 6.0E-08
sp|Q54KM9|RB11B_DICDI Ras-related protein Rab-11B OS=Dictyostelium discoideum GN=rab11B PE=2 SV=1 20 146 6.0E-08
sp|Q54YV7|ARFL_DICDI ADP-ribosylation factor L OS=Dictyostelium discoideum GN=arrL PE=3 SV=1 28 182 6.0E-08
sp|Q558I0|RABF1_DICDI Ras-related protein RabF1 OS=Dictyostelium discoideum GN=rabF1-1 PE=3 SV=1 28 182 7.0E-08
sp|Q8SS09|SAR1_ENCCU Small COPII coat GTPase SAR1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=SAR1 PE=1 SV=1 26 137 7.0E-08
sp|P38555|YPT31_YEAST GTP-binding protein YPT31/YPT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT31 PE=1 SV=3 26 137 8.0E-08
sp|Q08CX1|RASEF_XENTR Ras and EF-hand domain-containing protein OS=Xenopus tropicalis GN=rasef PE=2 SV=1 26 137 8.0E-08
sp|Q9ZRE2|RABD1_ARATH Ras-related protein RABD1 OS=Arabidopsis thaliana GN=RABD1 PE=1 SV=1 28 137 8.0E-08
sp|P31022|RAB7_PEA Ras-related protein Rab7 OS=Pisum sativum PE=2 SV=1 24 184 9.0E-08
sp|O24461|RAB7_PRUAR Ras-related protein Rab7 OS=Prunus armeniaca PE=2 SV=1 16 184 9.0E-08
sp|Q20365|RAB33_CAEEL Ras-related protein Rab-33 OS=Caenorhabditis elegans GN=rab-33 PE=2 SV=1 26 145 9.0E-08
sp|Q54DA7|RAB4_DICDI Ras-related protein Rab-4 OS=Dictyostelium discoideum GN=rab4 PE=3 SV=1 28 143 1.0E-07
sp|Q9XER8|RAB7_GOSHI Ras-related protein Rab7 OS=Gossypium hirsutum GN=RAB7 PE=2 SV=1 16 184 1.0E-07
sp|Q8BHC1|RB39B_MOUSE Ras-related protein Rab-39B OS=Mus musculus GN=Rab39b PE=1 SV=1 23 143 1.0E-07
sp|Q96DA2|RB39B_HUMAN Ras-related protein Rab-39B OS=Homo sapiens GN=RAB39B PE=1 SV=1 23 143 1.0E-07
sp|Q9SID8|RAH1D_ARATH Ras-related protein RABH1d OS=Arabidopsis thaliana GN=RABH1D PE=3 SV=1 28 165 1.0E-07
sp|Q17QU4|RB39B_BOVIN Ras-related protein Rab-39B OS=Bos taurus GN=RAB39B PE=2 SV=1 23 143 1.0E-07
sp|Q9ULW5|RAB26_HUMAN Ras-related protein Rab-26 OS=Homo sapiens GN=RAB26 PE=1 SV=3 26 136 1.0E-07
sp|Q1KME6|RAB6A_CHICK Ras-related protein Rab-6A OS=Gallus gallus GN=RAB6A PE=2 SV=3 28 145 1.0E-07
sp|Q9FLQ3|RAN4_ARATH GTP-binding nuclear protein Ran-4 OS=Arabidopsis thaliana GN=RAN4 PE=3 SV=1 28 182 1.0E-07
sp|P31583|RHN1_NICPL Ras-related protein RHN1 OS=Nicotiana plumbaginifolia GN=RHN1 PE=2 SV=1 22 145 1.0E-07
sp|B5YEQ1|OBG_DICT6 GTPase Obg OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=obg PE=3 SV=1 10 183 1.0E-07
sp|Q8VEA8|RAB7B_MOUSE Ras-related protein Rab-7b OS=Mus musculus GN=Rab7b PE=1 SV=1 20 186 2.0E-07
sp|Q96AH8|RAB7B_HUMAN Ras-related protein Rab-7b OS=Homo sapiens GN=RAB7B PE=2 SV=1 20 186 2.0E-07
sp|Q28IZ3|RAB19_XENTR Ras-related protein Rab-19 OS=Xenopus tropicalis GN=rab19 PE=2 SV=1 26 182 2.0E-07
sp|P35295|RAB20_MOUSE Ras-related protein Rab-20 OS=Mus musculus GN=Rab20 PE=2 SV=2 20 137 2.0E-07
sp|P51159|RB27A_HUMAN Ras-related protein Rab-27A OS=Homo sapiens GN=RAB27A PE=1 SV=3 29 181 2.0E-07
sp|Q5ZLG1|RAB18_CHICK Ras-related protein Rab-18 OS=Gallus gallus GN=RAB18 PE=2 SV=1 24 136 2.0E-07
sp|Q3T0F5|RAB7A_BOVIN Ras-related protein Rab-7a OS=Bos taurus GN=RAB7A PE=2 SV=1 24 184 2.0E-07
sp|Q96E17|RAB3C_HUMAN Ras-related protein Rab-3C OS=Homo sapiens GN=RAB3C PE=2 SV=1 28 137 2.0E-07
sp|Q9C2L8|RAB7_NEUCR Probable Ras-related protein Rab7 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=17E5.300 PE=3 SV=1 24 184 2.0E-07
sp|P10949|RAB3C_BOVIN Ras-related protein Rab-3C OS=Bos taurus GN=RAB3C PE=2 SV=3 28 137 2.0E-07
sp|Q0IIG8|RAB18_BOVIN Ras-related protein Rab-18 OS=Bos taurus GN=RAB18 PE=2 SV=1 24 185 2.0E-07
sp|Q5RAV6|RAB6A_PONAB Ras-related protein Rab-6A OS=Pongo abelii GN=RAB6A PE=2 SV=3 28 145 2.0E-07
sp|P20340|RAB6A_HUMAN Ras-related protein Rab-6A OS=Homo sapiens GN=RAB6A PE=1 SV=3 28 145 2.0E-07
sp|Q5R5H5|RAB18_PONAB Ras-related protein Rab-18 OS=Pongo abelii GN=RAB18 PE=2 SV=1 24 136 2.0E-07
sp|Q9NP72|RAB18_HUMAN Ras-related protein Rab-18 OS=Homo sapiens GN=RAB18 PE=1 SV=1 24 136 2.0E-07
sp|Q9WVB1|RAB6A_RAT Ras-related protein Rab-6A OS=Rattus norvegicus GN=Rab6a PE=1 SV=2 28 145 2.0E-07
sp|P35279|RAB6A_MOUSE Ras-related protein Rab-6A OS=Mus musculus GN=Rab6a PE=1 SV=4 28 145 2.0E-07
sp|Q55EF0|RABT2_DICDI Ras-related protein RabT2 OS=Dictyostelium discoideum GN=rabT2 PE=3 SV=1 24 182 2.0E-07
sp|P90726|RAB18_CAEBR Ras-related protein Rab-18 OS=Caenorhabditis briggsae GN=rab-18 PE=3 SV=1 24 140 2.0E-07
sp|Q8MXS1|RAB18_CAEEL Ras-related protein Rab-18 OS=Caenorhabditis elegans GN=rab-18 PE=3 SV=1 24 145 2.0E-07
sp|Q5RI75|RASEF_MOUSE Ras and EF-hand domain-containing protein homolog OS=Mus musculus GN=Rasef PE=1 SV=1 26 137 3.0E-07
sp|O97572|RAB7A_RABIT Ras-related protein Rab-7a OS=Oryctolagus cuniculus GN=RAB7A PE=2 SV=1 24 184 3.0E-07
sp|Q9NX57|RAB20_HUMAN Ras-related protein Rab-20 OS=Homo sapiens GN=RAB20 PE=1 SV=1 20 137 3.0E-07
sp|Q6DHC1|RB18B_DANRE Ras-related protein Rab-18-B OS=Danio rerio GN=rab18b PE=2 SV=1 24 136 4.0E-07
sp|P62824|RAB3C_RAT Ras-related protein Rab-3C OS=Rattus norvegicus GN=Rab3c PE=1 SV=1 28 137 4.0E-07
sp|P62823|RAB3C_MOUSE Ras-related protein Rab-3C OS=Mus musculus GN=Rab3c PE=1 SV=1 28 137 4.0E-07
sp|Q4LE85|RB27A_PIG Ras-related protein Rab-27A OS=Sus scrofa GN=RAB27A PE=2 SV=1 29 145 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0032553 ribonucleotide binding No
GO:0043168 anion binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032561 guanyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0003824 catalytic activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901265 nucleoside phosphate binding No
GO:0019001 guanyl nucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4867
MHYHVRFVVESWLLTVVTTRAMEMDVTLVGLQNAGKTSLLRVLAGGEFTLDSIPTVGFNMKRVQRGHVSLKCWDI
GGQPRFRSMWERYCRGVNAIVFIVDIADVALIPQAKEELHSLMGHTSLGGIPLLVLGNKSDLPRKLSVDELIDEL
DLKSITGREVCCYGISAKEETNLEAVVQFLVKWASR
Coding >Ophio5|4867
ATGCACTATCACGTCCGGTTCGTCGTCGAGAGTTGGCTGCTGACCGTTGTGACAACCAGGGCCATGGAGATGGAT
GTCACACTTGTCGGTCTCCAAAATGCTGGCAAAACATCGCTGTTACGAGTCCTGGCGGGCGGCGAGTTCACGCTG
GACTCGATACCGACCGTTGGCTTCAACATGAAGCGCGTGCAGCGGGGTCACGTCTCGTTGAAATGCTGGGACATC
GGTGGTCAGCCGCGGTTTCGGTCGATGTGGGAGAGGTACTGTCGGGGCGTCAACGCCATTGTCTTTATCGTAGAC
ATTGCCGACGTAGCGCTGATCCCGCAAGCCAAAGAAGAACTCCACTCACTCATGGGCCACACTTCGCTCGGCGGC
ATCCCCCTCCTTGTCCTGGGAAACAAGTCTGATCTTCCGCGGAAGCTGTCGGTTGACGAGCTGATTGACGAGCTG
GACCTCAAGAGCATCACGGGCCGCGAGGTGTGCTGCTACGGCATCAGTGCCAAGGAGGAGACGAACCTCGAGGCT
GTGGTGCAGTTTCTGGTCAAGTGGGCCAGCCGC
Transcript >Ophio5|4867
ATGCACTATCACGTCCGGTTCGTCGTCGAGAGTTGGCTGCTGACCGTTGTGACAACCAGGGCCATGGAGATGGAT
GTCACACTTGTCGGTCTCCAAAATGCTGGCAAAACATCGCTGTTACGAGTCCTGGCGGGCGGCGAGTTCACGCTG
GACTCGATACCGACCGTTGGCTTCAACATGAAGCGCGTGCAGCGGGGTCACGTCTCGTTGAAATGCTGGGACATC
GGTGGTCAGCCGCGGTTTCGGTCGATGTGGGAGAGGTACTGTCGGGGCGTCAACGCCATTGTCTTTATCGTAGAC
ATTGCCGACGTAGCGCTGATCCCGCAAGCCAAAGAAGAACTCCACTCACTCATGGGCCACACTTCGCTCGGCGGC
ATCCCCCTCCTTGTCCTGGGAAACAAGTCTGATCTTCCGCGGAAGCTGTCGGTTGACGAGCTGATTGACGAGCTG
GACCTCAAGAGCATCACGGGCCGCGAGGTGTGCTGCTACGGCATCAGTGCCAAGGAGGAGACGAACCTCGAGGCT
GTGGTGCAGTTTCTGGTCAAGTGGGCCAGCCGCTGA
Gene >Ophio5|4867
ATGCACTATCACGTCCGGTTCGTCGTCGAGAGTTGGCTGCTGACCGTTGTGACAACCAGGGCCATGGAGATGGAT
GTCACACTTGTCGGTCTCCAAAATGCTGGCAAAACATCGCTGTTACGAGTCCTGGCGGTAGGTCGTCAGAGTCCC
CTTTGCGCCATCTTGCGAGCCGCATGACTGACGTTGTTTCCTTTAGGGCGGCGAGTTCACGCTGGAGTGAGCATG
TACCCTTTTCACAACGATGCTCTCGCACTCCGCCTCTTGCCTCGCCTATCCCCCCCCCCCCCTCTCTTTCTCTCT
CCGTTTCCCTTTCTCTCATCTCCTCCCTGGACCTCCAGCCTCTTGATCTCCGAACCCTTTCTCCGTCTTCTCGCT
CCCCTTCCCGGTCTGACGTGGTCAAGCGGGCTGACTCGTCGTTCCCCCACAGCTCGATACCGACCGTTGGCTTCA
ACATGAAGCGCGTGCAGCGGGGTCACGTCTCGTTGAAATGCTGGGACATCGGTGGTCAGCCGCGGTTTCGGTCGA
TGTGGGAGAGGTACTGTCGGGGCGTCAACGCCATTGTCTTTATCGTAGACATTGCCGACGTAGCGCTGATCCCGC
AAGCCAAAGAAGAACTCCACTCACTCATGGGCCACACTTCGCTCGGCGGCATCCCCCTCCTTGTCCTGGGAAACA
AGTCTGATCTTCCGCGGAAGCTGTCGGTTGACGAGCTGATTGACGAGCTGGACCTCAAGAGCATCACGGGCCGCG
AGGTGTGCTGCTACGGCATCAGTGCCAAGGAGGAGACGAACCTCGAGGCTGTGGTGCAGTTTCTGGTCAAGTGGG
CCAGCCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail