Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4858
Gene name
Locationscaffold_39:43940..45860
Strand-
Gene length (bp)1920
Transcript length (bp)1920
Coding sequence length (bp)1917
Protein length (aa) 639

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40533|TED1_YEAST Protein TED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TED1 PE=1 SV=1 80 575 6.0E-51
sp|O42841|YFH2_SCHPO Uncharacterized protein C23A1.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23A1.02c PE=4 SV=2 205 549 4.0E-22

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 73 95 22
2 574 596 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4858
MAADSAPVPTRPLFRSIAALQVSKQQQTTNNTKTPGEGLVLTDSQPCPSSHQCRPNLAHAIGYMLVAAYLRHGLR
LLVPLAIACTIYLYLYPVFSGCAFPVQSRDPREAFDKTKHLHWPFASSSSEHTVDEFAPFRLLALGDPQLEGDTS
IPIAYLGILPHLKSLALRLAFRLEHAHLRDRVRMVLHDVIDLFLEDVPNLVESIRKRFDLFGNDFYLAHIYRTLR
WWSRPTHVSVLGDLVGSQWIENREFERRGRRFWNRAFRGGERVPDDVAAYPSQNHTIAGFLDGSTDERVWTRRIM
NVVGNHDIGYAGDLTAERMERFERVFGKSNYELRFALPIRDPMVNATILDKAANPASRRLPPQIRVLVLNDMNLD
TPAKDQGLQDLTYQFINDAISSAPAVENRGQFTLVLTHIPLHKPNGICVDGPFFDFYSPEEGGGVREQYLLSPDA
SKGLLEGVFGLSGNTGGPGKGLGRSGLVLNGHDHEGCDTFHFINQTNGTTVADRSWETARWADARARSLPGQHML
PGRREITVRSMMGDFGGNAGLLSMWFNQTTWEWEYEYRDCPLGRQHFWWLTHFLDLGVVLCALLYPFILALERRG
VDVDGRFLRVVDWTRRKVEALGREGVKRLSTKRPSMTPS
Coding >Ophio5|4858
ATGGCAGCTGACTCAGCCCCCGTTCCAACGCGGCCCCTTTTCCGGTCGATTGCCGCTCTCCAAGTCTCAAAACAA
CAACAGACGACGAACAACACAAAAACCCCCGGAGAAGGCCTCGTGCTGACTGACTCGCAGCCTTGTCCTTCCTCC
CATCAATGTCGCCCTAATCTTGCTCATGCGATCGGCTACATGTTGGTCGCGGCTTATCTCCGCCACGGCTTGCGC
CTGCTGGTGCCTCTGGCGATAGCCTGCACCATCTATCTCTATCTCTACCCGGTCTTCAGCGGATGCGCCTTTCCC
GTCCAGTCGAGGGATCCCCGCGAGGCGTTTGATAAGACGAAGCATCTTCATTGGCCCTTTGCCTCTTCTTCGTCC
GAACATACCGTCGACGAGTTTGCACCCTTCCGCCTGCTGGCTCTGGGCGATCCCCAGCTCGAGGGCGACACCTCT
ATCCCCATCGCCTATCTGGGCATCCTGCCTCACCTGAAGAGCCTTGCCCTGCGGCTGGCTTTTCGGCTAGAGCAC
GCTCACCTGCGGGACCGTGTCCGCATGGTGCTGCACGACGTCATCGATCTGTTCCTTGAAGACGTTCCGAATCTC
GTTGAGTCGATCCGCAAACGCTTCGATCTCTTCGGCAACGACTTTTATCTGGCCCACATATATCGCACGCTGCGA
TGGTGGTCTCGCCCGACTCATGTCTCCGTCCTGGGTGACCTTGTCGGCAGCCAGTGGATCGAGAATCGCGAGTTT
GAGAGGAGGGGGCGACGCTTTTGGAACAGGGCATTCAGAGGCGGTGAGAGGGTGCCGGACGATGTTGCGGCATAT
CCGTCGCAAAATCACACCATCGCCGGCTTCCTCGACGGCTCGACCGACGAACGCGTCTGGACGAGAAGGATCATG
AACGTGGTGGGCAACCACGACATCGGGTACGCCGGGGATCTAACCGCCGAGCGTATGGAGAGGTTTGAGCGTGTC
TTCGGCAAGTCCAATTACGAACTCCGCTTCGCACTGCCCATCCGTGACCCCATGGTCAACGCCACCATCCTCGAC
AAGGCGGCCAACCCGGCATCTCGACGCTTGCCGCCGCAGATCCGCGTGCTGGTGCTCAACGACATGAATCTCGAC
ACGCCTGCCAAGGACCAGGGGCTACAGGACCTGACGTACCAGTTCATCAACGACGCTATCAGCTCAGCCCCAGCC
GTGGAGAACCGCGGCCAGTTCACGCTGGTACTGACGCACATTCCGCTGCACAAACCCAACGGCATCTGCGTCGAC
GGTCCTTTTTTCGATTTTTACTCGCCCGAAGAGGGCGGAGGCGTCAGGGAGCAGTACCTCCTCAGCCCGGACGCG
AGCAAGGGCCTCCTGGAGGGCGTCTTCGGTCTGAGCGGCAATACGGGCGGGCCGGGCAAGGGCCTGGGCCGCAGC
GGACTCGTCCTCAACGGTCACGATCACGAGGGCTGTGACACGTTCCACTTCATCAACCAGACAAACGGCACCACC
GTCGCGGATCGGTCCTGGGAAACGGCGCGCTGGGCCGACGCGCGGGCCCGGAGCCTGCCGGGGCAGCACATGCTC
CCTGGCCGAAGGGAAATTACGGTCCGGAGCATGATGGGCGACTTTGGCGGCAACGCGGGCTTGCTGAGCATGTGG
TTCAACCAGACGACGTGGGAGTGGGAATACGAGTATAGGGATTGCCCGCTCGGACGGCAGCATTTCTGGTGGCTG
ACGCATTTCCTCGACCTGGGTGTCGTCCTGTGCGCCTTGCTTTATCCGTTCATCCTGGCACTGGAGAGGCGAGGC
GTCGATGTCGATGGCCGCTTCTTGCGCGTTGTCGACTGGACGAGGCGAAAAGTAGAGGCGCTGGGGAGAGAGGGT
GTCAAGCGGCTGTCGACCAAGAGACCCAGCATGACGCCATCA
Transcript >Ophio5|4858
ATGGCAGCTGACTCAGCCCCCGTTCCAACGCGGCCCCTTTTCCGGTCGATTGCCGCTCTCCAAGTCTCAAAACAA
CAACAGACGACGAACAACACAAAAACCCCCGGAGAAGGCCTCGTGCTGACTGACTCGCAGCCTTGTCCTTCCTCC
CATCAATGTCGCCCTAATCTTGCTCATGCGATCGGCTACATGTTGGTCGCGGCTTATCTCCGCCACGGCTTGCGC
CTGCTGGTGCCTCTGGCGATAGCCTGCACCATCTATCTCTATCTCTACCCGGTCTTCAGCGGATGCGCCTTTCCC
GTCCAGTCGAGGGATCCCCGCGAGGCGTTTGATAAGACGAAGCATCTTCATTGGCCCTTTGCCTCTTCTTCGTCC
GAACATACCGTCGACGAGTTTGCACCCTTCCGCCTGCTGGCTCTGGGCGATCCCCAGCTCGAGGGCGACACCTCT
ATCCCCATCGCCTATCTGGGCATCCTGCCTCACCTGAAGAGCCTTGCCCTGCGGCTGGCTTTTCGGCTAGAGCAC
GCTCACCTGCGGGACCGTGTCCGCATGGTGCTGCACGACGTCATCGATCTGTTCCTTGAAGACGTTCCGAATCTC
GTTGAGTCGATCCGCAAACGCTTCGATCTCTTCGGCAACGACTTTTATCTGGCCCACATATATCGCACGCTGCGA
TGGTGGTCTCGCCCGACTCATGTCTCCGTCCTGGGTGACCTTGTCGGCAGCCAGTGGATCGAGAATCGCGAGTTT
GAGAGGAGGGGGCGACGCTTTTGGAACAGGGCATTCAGAGGCGGTGAGAGGGTGCCGGACGATGTTGCGGCATAT
CCGTCGCAAAATCACACCATCGCCGGCTTCCTCGACGGCTCGACCGACGAACGCGTCTGGACGAGAAGGATCATG
AACGTGGTGGGCAACCACGACATCGGGTACGCCGGGGATCTAACCGCCGAGCGTATGGAGAGGTTTGAGCGTGTC
TTCGGCAAGTCCAATTACGAACTCCGCTTCGCACTGCCCATCCGTGACCCCATGGTCAACGCCACCATCCTCGAC
AAGGCGGCCAACCCGGCATCTCGACGCTTGCCGCCGCAGATCCGCGTGCTGGTGCTCAACGACATGAATCTCGAC
ACGCCTGCCAAGGACCAGGGGCTACAGGACCTGACGTACCAGTTCATCAACGACGCTATCAGCTCAGCCCCAGCC
GTGGAGAACCGCGGCCAGTTCACGCTGGTACTGACGCACATTCCGCTGCACAAACCCAACGGCATCTGCGTCGAC
GGTCCTTTTTTCGATTTTTACTCGCCCGAAGAGGGCGGAGGCGTCAGGGAGCAGTACCTCCTCAGCCCGGACGCG
AGCAAGGGCCTCCTGGAGGGCGTCTTCGGTCTGAGCGGCAATACGGGCGGGCCGGGCAAGGGCCTGGGCCGCAGC
GGACTCGTCCTCAACGGTCACGATCACGAGGGCTGTGACACGTTCCACTTCATCAACCAGACAAACGGCACCACC
GTCGCGGATCGGTCCTGGGAAACGGCGCGCTGGGCCGACGCGCGGGCCCGGAGCCTGCCGGGGCAGCACATGCTC
CCTGGCCGAAGGGAAATTACGGTCCGGAGCATGATGGGCGACTTTGGCGGCAACGCGGGCTTGCTGAGCATGTGG
TTCAACCAGACGACGTGGGAGTGGGAATACGAGTATAGGGATTGCCCGCTCGGACGGCAGCATTTCTGGTGGCTG
ACGCATTTCCTCGACCTGGGTGTCGTCCTGTGCGCCTTGCTTTATCCGTTCATCCTGGCACTGGAGAGGCGAGGC
GTCGATGTCGATGGCCGCTTCTTGCGCGTTGTCGACTGGACGAGGCGAAAAGTAGAGGCGCTGGGGAGAGAGGGT
GTCAAGCGGCTGTCGACCAAGAGACCCAGCATGACGCCATCATAA
Gene >Ophio5|4858
ATGGCAGCTGACTCAGCCCCCGTTCCAACGCGGCCCCTTTTCCGGTCGATTGCCGCTCTCCAAGTCTCAAAACAA
CAACAGACGACGAACAACACAAAAACCCCCGGAGAAGGCCTCGTGCTGACTGACTCGCAGCCTTGTCCTTCCTCC
CATCAATGTCGCCCTAATCTTGCTCATGCGATCGGCTACATGTTGGTCGCGGCTTATCTCCGCCACGGCTTGCGC
CTGCTGGTGCCTCTGGCGATAGCCTGCACCATCTATCTCTATCTCTACCCGGTCTTCAGCGGATGCGCCTTTCCC
GTCCAGTCGAGGGATCCCCGCGAGGCGTTTGATAAGACGAAGCATCTTCATTGGCCCTTTGCCTCTTCTTCGTCC
GAACATACCGTCGACGAGTTTGCACCCTTCCGCCTGCTGGCTCTGGGCGATCCCCAGCTCGAGGGCGACACCTCT
ATCCCCATCGCCTATCTGGGCATCCTGCCTCACCTGAAGAGCCTTGCCCTGCGGCTGGCTTTTCGGCTAGAGCAC
GCTCACCTGCGGGACCGTGTCCGCATGGTGCTGCACGACGTCATCGATCTGTTCCTTGAAGACGTTCCGAATCTC
GTTGAGTCGATCCGCAAACGCTTCGATCTCTTCGGCAACGACTTTTATCTGGCCCACATATATCGCACGCTGCGA
TGGTGGTCTCGCCCGACTCATGTCTCCGTCCTGGGTGACCTTGTCGGCAGCCAGTGGATCGAGAATCGCGAGTTT
GAGAGGAGGGGGCGACGCTTTTGGAACAGGGCATTCAGAGGCGGTGAGAGGGTGCCGGACGATGTTGCGGCATAT
CCGTCGCAAAATCACACCATCGCCGGCTTCCTCGACGGCTCGACCGACGAACGCGTCTGGACGAGAAGGATCATG
AACGTGGTGGGCAACCACGACATCGGGTACGCCGGGGATCTAACCGCCGAGCGTATGGAGAGGTTTGAGCGTGTC
TTCGGCAAGTCCAATTACGAACTCCGCTTCGCACTGCCCATCCGTGACCCCATGGTCAACGCCACCATCCTCGAC
AAGGCGGCCAACCCGGCATCTCGACGCTTGCCGCCGCAGATCCGCGTGCTGGTGCTCAACGACATGAATCTCGAC
ACGCCTGCCAAGGACCAGGGGCTACAGGACCTGACGTACCAGTTCATCAACGACGCTATCAGCTCAGCCCCAGCC
GTGGAGAACCGCGGCCAGTTCACGCTGGTACTGACGCACATTCCGCTGCACAAACCCAACGGCATCTGCGTCGAC
GGTCCTTTTTTCGATTTTTACTCGCCCGAAGAGGGCGGAGGCGTCAGGGAGCAGTACCTCCTCAGCCCGGACGCG
AGCAAGGGCCTCCTGGAGGGCGTCTTCGGTCTGAGCGGCAATACGGGCGGGCCGGGCAAGGGCCTGGGCCGCAGC
GGACTCGTCCTCAACGGTCACGATCACGAGGGCTGTGACACGTTCCACTTCATCAACCAGACAAACGGCACCACC
GTCGCGGATCGGTCCTGGGAAACGGCGCGCTGGGCCGACGCGCGGGCCCGGAGCCTGCCGGGGCAGCACATGCTC
CCTGGCCGAAGGGAAATTACGGTCCGGAGCATGATGGGCGACTTTGGCGGCAACGCGGGCTTGCTGAGCATGTGG
TTCAACCAGACGACGTGGGAGTGGGAATACGAGTATAGGGATTGCCCGCTCGGACGGCAGCATTTCTGGTGGCTG
ACGCATTTCCTCGACCTGGGTGTCGTCCTGTGCGCCTTGCTTTATCCGTTCATCCTGGCACTGGAGAGGCGAGGC
GTCGATGTCGATGGCCGCTTCTTGCGCGTTGTCGACTGGACGAGGCGAAAAGTAGAGGCGCTGGGGAGAGAGGGT
GTCAAGCGGCTGTCGACCAAGAGACCCAGCATGACGCCATCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail