Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4846
Gene name
Locationscaffold_39:22620..24161
Strand-
Gene length (bp)1541
Transcript length (bp)1446
Coding sequence length (bp)1443
Protein length (aa) 481

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 5.4E-23 25 132

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 17 240 2.0E-47
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 15 192 2.0E-31
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 4 253 3.0E-29
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 17 229 6.0E-26
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 7 250 2.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 17 240 2.0E-47
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 15 192 2.0E-31
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 4 253 3.0E-29
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 17 229 6.0E-26
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 7 250 2.0E-23
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 14 140 2.0E-23
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 4 140 5.0E-22
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 4 140 7.0E-22
sp|O13704|YEU5_SCHPO Thioredoxin domain-containing protein C13F5.05, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.05 PE=3 SV=2 23 179 7.0E-22
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 4 140 1.0E-21
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 4 140 2.0E-21
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 31 251 2.0E-20
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 1 133 2.0E-19
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 25 242 3.0E-19
sp|Q9SRG3|PDI12_ARATH Protein disulfide isomerase-like 1-2 OS=Arabidopsis thaliana GN=PDIL1-2 PE=2 SV=1 25 129 7.0E-19
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 23 223 1.0E-18
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 28 246 2.0E-18
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 4 222 8.0E-18
sp|Q43116|PDI_RICCO Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1 4 132 9.0E-18
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 25 242 1.0E-17
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 1 242 2.0E-17
sp|Q9XF61|PDI_DATGL Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1 25 132 2.0E-17
sp|Q8JGM4|QSOX1_CHICK Sulfhydryl oxidase 1 OS=Gallus gallus GN=QSOX1 PE=1 SV=1 15 210 3.0E-17
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 26 128 5.0E-17
sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 23 132 6.0E-17
sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 23 132 7.0E-17
sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 23 132 7.0E-17
sp|Q4VIT4|PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops GN=PDIA3 PE=2 SV=1 45 132 7.0E-17
sp|P11598|PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2 45 132 8.0E-17
sp|P27773|PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2 45 132 8.0E-17
sp|Q9XI01|PDI11_ARATH Protein disulfide isomerase-like 1-1 OS=Arabidopsis thaliana GN=PDIL1-1 PE=1 SV=1 25 129 1.0E-16
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 44 242 1.0E-16
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 4 246 2.0E-16
sp|H2N4I1|QSOX1_PONAB Sulfhydryl oxidase 1 OS=Pongo abelii GN=QSOX1 PE=3 SV=2 17 218 2.0E-16
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 23 254 3.0E-16
sp|Q8JG64|PDIA3_CHICK Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1 22 129 3.0E-16
sp|O00391|QSOX1_HUMAN Sulfhydryl oxidase 1 OS=Homo sapiens GN=QSOX1 PE=1 SV=3 17 218 3.0E-16
sp|P17967|PDI_YEAST Protein disulfide-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDI1 PE=1 SV=2 16 133 3.0E-16
sp|P52589|PDI_WHEAT Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1 25 207 5.0E-16
sp|Q53LQ0|PDI11_ORYSJ Protein disulfide isomerase-like 1-1 OS=Oryza sativa subsp. japonica GN=PDIL1-1 PE=2 SV=1 25 132 6.0E-16
sp|P80284|PDI_HORVU Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2 25 207 1.0E-15
sp|Q0JD42|PDI52_ORYSJ Protein disulfide isomerase-like 5-2 OS=Oryza sativa subsp. japonica GN=PDIL5-2 PE=2 SV=2 19 281 2.0E-15
sp|Q8BND5|QSOX1_MOUSE Sulfhydryl oxidase 1 OS=Mus musculus GN=Qsox1 PE=1 SV=1 18 210 2.0E-15
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 20 162 2.0E-15
sp|P38658|ERP60_SCHMA Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1 7 175 5.0E-15
sp|P52588|PDI_MAIZE Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1 25 129 5.0E-15
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 44 235 5.0E-15
sp|O08841|QSOX1_CAVPO Sulfhydryl oxidase 1 OS=Cavia porcellus GN=QSOX1 PE=2 SV=2 14 366 6.0E-15
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 25 139 7.0E-15
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 25 139 7.0E-15
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 17 135 1.0E-14
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 23 246 1.0E-14
sp|P29828|PDI_MEDSA Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1 25 132 2.0E-14
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 22 180 2.0E-14
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 25 139 3.0E-14
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 25 139 3.0E-14
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 25 139 3.0E-14
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 1 156 3.0E-14
sp|Q6ZRP7|QSOX2_HUMAN Sulfhydryl oxidase 2 OS=Homo sapiens GN=QSOX2 PE=1 SV=3 25 273 8.0E-14
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 23 135 2.0E-13
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 23 135 2.0E-13
sp|Q17770|PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1 1 129 2.0E-13
sp|P54399|PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1 25 261 2.0E-13
sp|Q3TMX7|QSOX2_MOUSE Sulfhydryl oxidase 2 OS=Mus musculus GN=Qsox2 PE=1 SV=1 4 273 2.0E-13
sp|Q0E0I1|PDI53_ORYSJ Protein disulfide isomerase-like 5-3 OS=Oryza sativa subsp. japonica GN=PDIL5-3 PE=3 SV=1 20 208 2.0E-13
sp|Q6IUU3|QSOX1_RAT Sulfhydryl oxidase 1 OS=Rattus norvegicus GN=Qsox1 PE=1 SV=1 18 210 3.0E-13
sp|Q50KB1|SEP2_EMIHU Protein disulfide-isomerase-like protein EhSep2 OS=Emiliania huxleyi GN=SEP2 PE=1 SV=2 26 124 5.0E-13
sp|Q13087|PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2 36 240 6.0E-13
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 25 129 1.0E-12
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 23 124 2.0E-12
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 39 246 2.0E-12
sp|P52588|PDI_MAIZE Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1 22 132 2.0E-12
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 45 135 2.0E-12
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 25 122 3.0E-12
sp|Q69ST6|PID13_ORYSJ Protein disulfide isomerase-like 1-3 OS=Oryza sativa subsp. japonica GN=PDIL1-3 PE=2 SV=1 25 129 3.0E-12
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 17 249 3.0E-12
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 36 240 3.0E-12
sp|P52589|PDI_WHEAT Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1 22 132 4.0E-12
sp|P80284|PDI_HORVU Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2 22 132 4.0E-12
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 25 148 5.0E-12
sp|Q7XRB5|PDI12_ORYSJ Protein disulfide isomerase-like 1-2 OS=Oryza sativa subsp. japonica GN=PDIL1-2 PE=2 SV=2 25 130 5.0E-12
sp|Q53LQ0|PDI11_ORYSJ Protein disulfide isomerase-like 1-1 OS=Oryza sativa subsp. japonica GN=PDIL1-1 PE=2 SV=1 24 132 6.0E-12
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 45 135 8.0E-12
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 25 132 8.0E-12
sp|P12865|BS2_TRYBB Bloodstream-specific protein 2 OS=Trypanosoma brucei brucei GN=BS2 PE=3 SV=1 45 147 1.0E-11
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 45 135 1.0E-11
sp|D3Z6P0|PDIA2_MOUSE Protein disulfide-isomerase A2 OS=Mus musculus GN=Pdia2 PE=1 SV=1 20 240 1.0E-11
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 30 135 2.0E-11
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 24 149 2.0E-11
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 25 132 2.0E-11
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 25 132 2.0E-11
sp|P09102|PDIA1_CHICK Protein disulfide-isomerase OS=Gallus gallus GN=P4HB PE=1 SV=3 25 109 2.0E-11
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 25 246 2.0E-11
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 28 249 2.0E-11
sp|Q9FF55|PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana GN=PDIL1-4 PE=1 SV=1 37 144 3.0E-11
sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 25 246 3.0E-11
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 25 132 4.0E-11
sp|Q9SRG3|PDI12_ARATH Protein disulfide isomerase-like 1-2 OS=Arabidopsis thaliana GN=PDIL1-2 PE=2 SV=1 24 132 5.0E-11
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 21 151 5.0E-11
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 45 137 6.0E-11
sp|Q5R5B6|PDIA1_PONAB Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1 25 246 6.0E-11
sp|P04785|PDIA1_RAT Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2 25 246 6.0E-11
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 45 137 7.0E-11
sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 25 246 7.0E-11
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 20 137 8.0E-11
sp|Q8VX13|PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 40 147 8.0E-11
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 21 134 9.0E-11
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 25 246 1.0E-10
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 24 124 1.0E-10
sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 24 113 2.0E-10
sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 24 113 2.0E-10
sp|Q4VIT4|PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops GN=PDIA3 PE=2 SV=1 24 113 2.0E-10
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 25 212 2.0E-10
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 1 147 3.0E-10
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 25 109 3.0E-10
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 25 109 3.0E-10
sp|P29828|PDI_MEDSA Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1 22 132 4.0E-10
sp|Q43116|PDI_RICCO Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1 19 132 5.0E-10
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 39 110 5.0E-10
sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 24 113 6.0E-10
sp|Q9XI01|PDI11_ARATH Protein disulfide isomerase-like 1-1 OS=Arabidopsis thaliana GN=PDIL1-1 PE=1 SV=1 24 135 6.0E-10
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 21 144 7.0E-10
sp|Q9XF61|PDI_DATGL Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1 22 132 8.0E-10
sp|Q17770|PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1 37 124 8.0E-10
sp|Q8R4U2|PDIA1_CRIGR Protein disulfide-isomerase OS=Cricetulus griseus GN=P4HB PE=2 SV=1 25 246 8.0E-10
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 45 143 9.0E-10
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 45 143 9.0E-10
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 45 144 9.0E-10
sp|Q9T042|PDI54_ARATH Protein disulfide-isomerase 5-4 OS=Arabidopsis thaliana GN=PDIL5-4 PE=2 SV=1 45 136 9.0E-10
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 45 249 9.0E-10
sp|P11598|PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2 24 113 1.0E-09
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 20 101 1.0E-09
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 45 135 1.0E-09
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 21 102 1.0E-09
sp|P27773|PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2 24 113 2.0E-09
sp|Q8JG64|PDIA3_CHICK Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1 24 115 2.0E-09
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 20 144 2.0E-09
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 21 102 2.0E-09
sp|Q67IX6|PDI14_ORYSJ Protein disulfide isomerase-like 1-4 OS=Oryza sativa subsp. japonica GN=PDIL1-4 PE=2 SV=1 34 120 2.0E-09
sp|Q6AX23|QSOX2_XENLA Sulfhydryl oxidase 2 OS=Xenopus laevis GN=qsox2 PE=2 SV=1 15 134 2.0E-09
sp|Q9FF55|PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana GN=PDIL1-4 PE=1 SV=1 28 123 3.0E-09
sp|Q7M1B9|THIO_CHLAA Thioredoxin OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=trxA PE=1 SV=3 26 101 3.0E-09
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 20 101 4.0E-09
sp|Q69SA9|PDI54_ORYSJ Protein disulfide isomerase-like 5-4 OS=Oryza sativa subsp. japonica GN=PDIL5-4 PE=2 SV=1 45 146 4.0E-09
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 21 101 6.0E-09
sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 25 246 6.0E-09
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 20 101 7.0E-09
sp|Q8BXZ1|TMX3_MOUSE Protein disulfide-isomerase TMX3 OS=Mus musculus GN=Tmx3 PE=1 SV=2 39 157 7.0E-09
sp|Q4N4N8|TXND_THEPA Thioredoxin domain-containing protein OS=Theileria parva GN=TP02_0602 PE=1 SV=1 43 101 7.0E-09
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 23 132 8.0E-09
sp|P09102|PDIA1_CHICK Protein disulfide-isomerase OS=Gallus gallus GN=P4HB PE=1 SV=3 24 124 9.0E-09
sp|Q67IX6|PDI14_ORYSJ Protein disulfide isomerase-like 1-4 OS=Oryza sativa subsp. japonica GN=PDIL1-4 PE=2 SV=1 25 161 9.0E-09
sp|P32474|EUG1_YEAST Protein disulfide-isomerase EUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EUG1 PE=1 SV=1 45 218 9.0E-09
sp|P54399|PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1 23 130 1.0E-08
sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 24 124 1.0E-08
sp|Q96JJ7|TMX3_HUMAN Protein disulfide-isomerase TMX3 OS=Homo sapiens GN=TMX3 PE=1 SV=2 39 130 1.0E-08
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 34 246 1.0E-08
sp|Q5R875|TMX3_PONAB Protein disulfide-isomerase TMX3 OS=Pongo abelii GN=TMX3 PE=2 SV=1 39 130 1.0E-08
sp|P0A4L2|THIO1_NOSSO Thioredoxin-1 OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=trxA PE=1 SV=2 27 101 1.0E-08
sp|P0A4L1|THIO1_NOSS1 Thioredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxA PE=3 SV=2 27 101 1.0E-08
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 35 102 2.0E-08
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 35 102 2.0E-08
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 42 109 2.0E-08
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 21 124 2.0E-08
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 20 102 3.0E-08
sp|P12865|BS2_TRYBB Bloodstream-specific protein 2 OS=Trypanosoma brucei brucei GN=BS2 PE=3 SV=1 14 147 4.0E-08
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 20 146 4.0E-08
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 21 101 4.0E-08
sp|Q94F09|PDI52_ARATH Protein disulfide-isomerase 5-2 OS=Arabidopsis thaliana GN=PDIL5-2 PE=1 SV=1 25 281 4.0E-08
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 21 124 4.0E-08
sp|Q8R4U2|PDIA1_CRIGR Protein disulfide-isomerase OS=Cricetulus griseus GN=P4HB PE=2 SV=1 24 124 6.0E-08
sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 24 124 6.0E-08
sp|Q6GNG3|TMX3_XENLA Protein disulfide-isomerase TMX3 OS=Xenopus laevis GN=tmx3 PE=2 SV=1 39 130 6.0E-08
sp|Q8VX13|PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 30 120 7.0E-08
sp|P00275|THIO1_CORNE Thioredoxin C-1 OS=Corynebacterium nephridii PE=1 SV=1 26 101 7.0E-08
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 18 136 8.0E-08
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 24 124 8.0E-08
sp|P04785|PDIA1_RAT Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2 24 124 8.0E-08
sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 45 124 9.0E-08
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 37 105 9.0E-08
sp|Q69ST6|PID13_ORYSJ Protein disulfide isomerase-like 1-3 OS=Oryza sativa subsp. japonica GN=PDIL1-3 PE=2 SV=1 24 101 1.0E-07
sp|Q5R5B6|PDIA1_PONAB Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1 45 124 1.0E-07
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 24 124 1.0E-07
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 37 105 1.0E-07
sp|P38658|ERP60_SCHMA Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1 22 132 2.0E-07
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 20 101 2.0E-07
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 24 123 3.0E-07
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 25 109 3.0E-07
sp|Q00002|PDI_ALTAL Protein disulfide-isomerase (Fragment) OS=Alternaria alternata PE=1 SV=2 24 80 3.0E-07
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 24 128 4.0E-07
sp|P50254|THIO_PYRYE Thioredoxin OS=Pyropia yezoensis GN=trxA PE=3 SV=1 25 101 4.0E-07
sp|P10473|THIO_RHORU Thioredoxin OS=Rhodospirillum rubrum GN=trxA PE=1 SV=1 27 114 4.0E-07
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 45 144 5.0E-07
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 24 124 5.0E-07
sp|O51088|THIO_BORBU Thioredoxin OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=trxA PE=3 SV=1 39 110 5.0E-07
sp|P52231|THIO_SYNY3 Thioredoxin OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trxA PE=1 SV=3 27 105 7.0E-07
sp|Q10N04|PDI51_ORYSJ Protein disulfide isomerase-like 5-1 OS=Oryza sativa subsp. japonica GN=PDIL5-1 PE=2 SV=1 25 135 7.0E-07
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 45 144 8.0E-07
sp|Q6AUC6|QSOX1_ORYSJ Sulfhydryl oxidase 1 OS=Oryza sativa subsp. japonica GN=QSOX1 PE=2 SV=1 44 101 8.0E-07
sp|Q9ZU40|QSOX2_ARATH Sulfhydryl oxidase 2 OS=Arabidopsis thaliana GN=QSOX2 PE=2 SV=2 7 101 9.0E-07
sp|Q13087|PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2 24 123 1.0E-06
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 45 144 1.0E-06
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 45 144 1.0E-06
sp|P43785|THIO_HAEIN Thioredoxin OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trxA PE=3 SV=1 23 105 1.0E-06
sp|P37395|THIO_CYACA Thioredoxin OS=Cyanidium caldarium GN=trxA PE=3 SV=1 26 101 1.0E-06
sp|P51225|THIO_PORPU Thioredoxin OS=Porphyra purpurea GN=trxA PE=3 SV=1 25 105 2.0E-06
sp|Q9ZP21|TRXM_WHEAT Thioredoxin M-type, chloroplastic OS=Triticum aestivum PE=2 SV=1 5 101 2.0E-06
sp|D3Z6P0|PDIA2_MOUSE Protein disulfide-isomerase A2 OS=Mus musculus GN=Pdia2 PE=1 SV=1 24 102 3.0E-06
sp|P0AGG7|THIO2_SHIFL Thioredoxin-2 OS=Shigella flexneri GN=trxC PE=3 SV=1 45 101 3.0E-06
sp|P0AGG4|THIO2_ECOLI Thioredoxin-2 OS=Escherichia coli (strain K12) GN=trxC PE=1 SV=1 45 101 3.0E-06
sp|P0AGG5|THIO2_ECOL6 Thioredoxin-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxC PE=3 SV=1 45 101 3.0E-06
sp|P0AGG6|THIO2_ECO57 Thioredoxin-2 OS=Escherichia coli O157:H7 GN=trxC PE=3 SV=1 45 101 3.0E-06
sp|P66928|THIO_HELPY Thioredoxin OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trxA PE=3 SV=1 43 101 3.0E-06
sp|P66929|THIO_HELPJ Thioredoxin OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trxA PE=3 SV=1 43 101 3.0E-06
sp|P33791|THIO_STRAU Thioredoxin (Fragment) OS=Streptomyces aureofaciens GN=trxA PE=3 SV=1 26 100 3.0E-06
sp|P48384|TRXM_PEA Thioredoxin M-type, chloroplastic OS=Pisum sativum PE=2 SV=1 1 101 4.0E-06
sp|P96132|THIO_THIRO Thioredoxin (Fragment) OS=Thiocapsa roseopersicina GN=trxA PE=3 SV=1 22 107 4.0E-06
sp|Q9X2T1|THIO_PSEAE Thioredoxin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trxA PE=3 SV=1 22 105 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4846
MHTITALVAALLPAAQAMYPKSSPVLQVDASSYNRLIARSNHTSLVEFYAPWCGHCQNLKPAYEKAAKNLDGLAK
VAAIDCDAETNKQFCSSMGVQGFPTLKTVRPSTKPGGKPVVEDYQGQRTSGAMVQAVVDKINNHVTRLSDKEIDA
FLSGDKPKAILFTNKGTTSALLRSIAIDYLDQVSIGQIRDREKAAVEKYGIETFPTFVLFPGKASSDVEKGEAPI
KYEGELNKKNLVEFLSQVAQPNPDPSPIDSKKKSKSDKKKKTKTEKAEDATEPSAETATEKETAETKPKAAMEII
PITAIKDKDVLVQKCLQLKSYTCVLALIPSEASEQGEKVVASLSQLNSKYLHGKRHLFPFFSVASDVEGTGALRD
ALKLGDSGVELIVLNARRGWWRRFEGDDLGVESVEGWIDAIRMGEGKKKTLPEGVVVEAAAETSEAVAKEATEAA
KAEKEAAKEEKKGEAKADDAAKESKIVHEEL
Coding >Ophio5|4846
ATGCATACCATCACGGCCCTCGTGGCCGCGCTGCTACCGGCCGCGCAGGCCATGTATCCTAAGAGTTCGCCCGTT
CTCCAGGTCGACGCTAGCTCTTACAATCGGCTCATTGCCCGGTCGAACCACACTTCGCTCGTCGAGTTCTACGCT
CCCTGGTGCGGCCACTGCCAGAACCTCAAGCCAGCTTACGAAAAGGCCGCCAAGAACCTAGATGGCCTCGCCAAA
GTCGCCGCCATCGACTGCGACGCCGAGACCAACAAGCAGTTCTGCTCCTCCATGGGCGTCCAGGGTTTCCCGACC
CTCAAGACGGTCCGTCCCAGCACCAAGCCCGGCGGTAAGCCCGTCGTCGAGGACTATCAGGGCCAGCGCACCTCA
GGCGCCATGGTTCAGGCTGTCGTCGACAAGATCAACAACCATGTCACTCGCCTATCCGACAAGGAAATCGACGCT
TTCCTCAGCGGCGATAAGCCGAAGGCCATCCTTTTCACCAACAAGGGCACCACCAGTGCTCTTCTCAGGAGTATC
GCCATCGACTATCTTGACCAGGTCTCCATCGGCCAGATCCGTGATAGGGAAAAGGCGGCTGTGGAAAAGTACGGT
ATCGAGACTTTTCCCACTTTTGTCCTCTTCCCCGGCAAGGCCTCTTCCGACGTCGAAAAGGGGGAGGCGCCCATC
AAGTATGAGGGAGAGCTGAACAAGAAGAACTTGGTCGAATTTTTGTCGCAGGTCGCCCAGCCCAATCCTGACCCC
TCGCCCATCGACAGCAAGAAGAAGAGCAAGAGCGACAAGAAGAAGAAGACGAAGACGGAAAAGGCCGAAGACGCA
ACAGAGCCGTCGGCCGAGACGGCAACAGAAAAAGAGACGGCGGAGACGAAGCCCAAGGCCGCCATGGAGATCATT
CCCATCACCGCCATCAAGGACAAGGACGTCCTGGTACAAAAGTGTCTTCAGCTCAAGTCCTACACCTGTGTGCTC
GCCCTCATCCCATCCGAGGCCTCGGAGCAGGGCGAAAAGGTGGTAGCGTCCCTCTCGCAGCTCAACAGCAAGTAC
CTCCACGGGAAGCGGCACCTGTTCCCCTTCTTCTCCGTTGCCAGCGACGTCGAAGGCACGGGGGCGCTACGAGAC
GCGCTCAAGCTCGGCGACTCGGGCGTCGAGCTCATCGTCTTAAACGCCCGTCGGGGCTGGTGGCGACGTTTCGAG
GGTGATGATTTGGGCGTCGAGAGCGTCGAGGGTTGGATTGATGCCATTCGTATGGGTGAGGGGAAGAAGAAGACA
TTGCCTGAGGGTGTGGTCGTCGAGGCGGCTGCCGAGACTTCTGAGGCGGTGGCCAAGGAGGCGACGGAGGCGGCC
AAGGCGGAGAAGGAGGCGGCCAAAGAAGAGAAGAAGGGGGAGGCCAAGGCGGACGATGCTGCCAAGGAGTCCAAG
ATTGTGCACGAGGAGCTC
Transcript >Ophio5|4846
ATGCATACCATCACGGCCCTCGTGGCCGCGCTGCTACCGGCCGCGCAGGCCATGTATCCTAAGAGTTCGCCCGTT
CTCCAGGTCGACGCTAGCTCTTACAATCGGCTCATTGCCCGGTCGAACCACACTTCGCTCGTCGAGTTCTACGCT
CCCTGGTGCGGCCACTGCCAGAACCTCAAGCCAGCTTACGAAAAGGCCGCCAAGAACCTAGATGGCCTCGCCAAA
GTCGCCGCCATCGACTGCGACGCCGAGACCAACAAGCAGTTCTGCTCCTCCATGGGCGTCCAGGGTTTCCCGACC
CTCAAGACGGTCCGTCCCAGCACCAAGCCCGGCGGTAAGCCCGTCGTCGAGGACTATCAGGGCCAGCGCACCTCA
GGCGCCATGGTTCAGGCTGTCGTCGACAAGATCAACAACCATGTCACTCGCCTATCCGACAAGGAAATCGACGCT
TTCCTCAGCGGCGATAAGCCGAAGGCCATCCTTTTCACCAACAAGGGCACCACCAGTGCTCTTCTCAGGAGTATC
GCCATCGACTATCTTGACCAGGTCTCCATCGGCCAGATCCGTGATAGGGAAAAGGCGGCTGTGGAAAAGTACGGT
ATCGAGACTTTTCCCACTTTTGTCCTCTTCCCCGGCAAGGCCTCTTCCGACGTCGAAAAGGGGGAGGCGCCCATC
AAGTATGAGGGAGAGCTGAACAAGAAGAACTTGGTCGAATTTTTGTCGCAGGTCGCCCAGCCCAATCCTGACCCC
TCGCCCATCGACAGCAAGAAGAAGAGCAAGAGCGACAAGAAGAAGAAGACGAAGACGGAAAAGGCCGAAGACGCA
ACAGAGCCGTCGGCCGAGACGGCAACAGAAAAAGAGACGGCGGAGACGAAGCCCAAGGCCGCCATGGAGATCATT
CCCATCACCGCCATCAAGGACAAGGACGTCCTGGTACAAAAGTGTCTTCAGCTCAAGTCCTACACCTGTGTGCTC
GCCCTCATCCCATCCGAGGCCTCGGAGCAGGGCGAAAAGGTGGTAGCGTCCCTCTCGCAGCTCAACAGCAAGTAC
CTCCACGGGAAGCGGCACCTGTTCCCCTTCTTCTCCGTTGCCAGCGACGTCGAAGGCACGGGGGCGCTACGAGAC
GCGCTCAAGCTCGGCGACTCGGGCGTCGAGCTCATCGTCTTAAACGCCCGTCGGGGCTGGTGGCGACGTTTCGAG
GGTGATGATTTGGGCGTCGAGAGCGTCGAGGGTTGGATTGATGCCATTCGTATGGGTGAGGGGAAGAAGAAGACA
TTGCCTGAGGGTGTGGTCGTCGAGGCGGCTGCCGAGACTTCTGAGGCGGTGGCCAAGGAGGCGACGGAGGCGGCC
AAGGCGGAGAAGGAGGCGGCCAAAGAAGAGAAGAAGGGGGAGGCCAAGGCGGACGATGCTGCCAAGGAGTCCAAG
ATTGTGCACGAGGAGCTCTGA
Gene >Ophio5|4846
ATGCATACCATCACGGCCCTCGTGGCCGCGCTGCTACCGGCCGCGCAGGCCATGTATCCTAAGAGTTCGCCCGTT
CTCCAGGTCGACGCTAGCTCTTACAATCGGCTCATTGCCCGGTCGAACCACACTTCGGTAGGCCCATGTGTCTTT
GGATGTTTGTTCGGTTCAGGCTTTCTCTGGAGCTATCCGCAAATGAATTCAGACTCCCCCGAGCTGACACGCCCC
AGCTCGTCGAGTTCTACGCTCCCTGGTGCGGCCACTGCCAGAACCTCAAGCCAGCTTACGAAAAGGCCGCCAAGA
ACCTAGATGGCCTCGCCAAAGTCGCCGCCATCGACTGCGACGCCGAGACCAACAAGCAGTTCTGCTCCTCCATGG
GCGTCCAGGGTTTCCCGACCCTCAAGACGGTCCGTCCCAGCACCAAGCCCGGCGGTAAGCCCGTCGTCGAGGACT
ATCAGGGCCAGCGCACCTCAGGCGCCATGGTTCAGGCTGTCGTCGACAAGATCAACAACCATGTCACTCGCCTAT
CCGACAAGGAAATCGACGCTTTCCTCAGCGGCGATAAGCCGAAGGCCATCCTTTTCACCAACAAGGGCACCACCA
GTGCTCTTCTCAGGAGTATCGCCATCGACTATCTTGACCAGGTCTCCATCGGCCAGATCCGTGATAGGGAAAAGG
CGGCTGTGGAAAAGTACGGTATCGAGACTTTTCCCACTTTTGTCCTCTTCCCCGGCAAGGCCTCTTCCGACGTCG
AAAAGGGGGAGGCGCCCATCAAGTATGAGGGAGAGCTGAACAAGAAGAACTTGGTCGAATTTTTGTCGCAGGTCG
CCCAGCCCAATCCTGACCCCTCGCCCATCGACAGCAAGAAGAAGAGCAAGAGCGACAAGAAGAAGAAGACGAAGA
CGGAAAAGGCCGAAGACGCAACAGAGCCGTCGGCCGAGACGGCAACAGAAAAAGAGACGGCGGAGACGAAGCCCA
AGGCCGCCATGGAGATCATTCCCATCACCGCCATCAAGGACAAGGACGTCCTGGTACAAAAGTGTCTTCAGCTCA
AGTCCTACACCTGTGTGCTCGCCCTCATCCCATCCGAGGCCTCGGAGCAGGGCGAAAAGGTGGTAGCGTCCCTCT
CGCAGCTCAACAGCAAGTACCTCCACGGGAAGCGGCACCTGTTCCCCTTCTTCTCCGTTGCCAGCGACGTCGAAG
GCACGGGGGCGCTACGAGACGCGCTCAAGCTCGGCGACTCGGGCGTCGAGCTCATCGTCTTAAACGCCCGTCGGG
GCTGGTGGCGACGTTTCGAGGGTGATGATTTGGGCGTCGAGAGCGTCGAGGGTTGGATTGATGCCATTCGTATGG
GTGAGGGGAAGAAGAAGACATTGCCTGAGGGTGTGGTCGTCGAGGCGGCTGCCGAGACTTCTGAGGCGGTGGCCA
AGGAGGCGACGGAGGCGGCCAAGGCGGAGAAGGAGGCGGCCAAAGAAGAGAAGAAGGGGGAGGCCAAGGCGGACG
ATGCTGCCAAGGAGTCCAAGATTGTGCACGAGGAGCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail