Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4844
Gene name
Locationscaffold_39:16257..19728
Strand+
Gene length (bp)3471
Transcript length (bp)3192
Coding sequence length (bp)3189
Protein length (aa) 1063

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 1.0E-72 516 787
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 5.4E-44 60 208
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 3.2E-23 231 504
PF12621 PHM7_ext Extracellular tail, of 10TM putative phosphate transporter 4.0E-23 964 1055

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 408 825 4.0E-93
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 413 1047 4.0E-85
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 54 825 3.0E-78
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 71 287 3.0E-39
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 419 883 3.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 408 825 4.0E-93
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 413 1047 4.0E-85
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 54 825 3.0E-78
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 71 287 3.0E-39
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 419 883 3.0E-35
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 67 300 8.0E-35
sp|Q9FVQ5|CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana GN=At1g32090 PE=1 SV=1 422 788 9.0E-29
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 415 868 1.0E-24
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 414 916 2.0E-24
sp|Q9C8G5|CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana GN=ERD4 PE=2 SV=1 414 844 3.0E-24
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 416 788 1.0E-22
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 419 810 1.0E-22
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 422 893 7.0E-22
sp|F4JCY2|CSCL8_ARATH CSC1-like protein At3g54510 OS=Arabidopsis thaliana GN=At3g54510 PE=2 SV=1 422 853 2.0E-21
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 422 786 5.0E-21
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 422 788 6.0E-20
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 422 822 1.0E-19
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 422 788 2.0E-19
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 423 805 2.0E-13
sp|Q94A87|CSCL9_ARATH CSC1-like protein At1g10090 OS=Arabidopsis thaliana GN=At1g10090 PE=1 SV=1 462 906 3.0E-13
sp|F4IBD7|CSCLA_ARATH CSC1-like protein RXW8 OS=Arabidopsis thaliana GN=RXW8 PE=2 SV=1 463 792 2.0E-12
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 42 285 5.0E-10
sp|F4I248|CSCLB_ARATH CSC1-like protein At1g69450 OS=Arabidopsis thaliana GN=At1g69450 PE=2 SV=1 421 875 5.0E-10
sp|Q8GUH7|CSCLC_ARATH CSC1-like protein HYP1 OS=Arabidopsis thaliana GN=HYP1 PE=2 SV=1 422 843 1.0E-09
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 69 303 5.0E-08
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 72 284 6.0E-07
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 105 379 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 60 82 22
2 143 165 22
3 187 206 19
4 520 542 22
5 562 584 22
6 610 632 22
7 658 680 22
8 720 742 22
9 762 784 22
10 791 813 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4844
MSEPLDALQGANVGRWLLRRGFLDIFKDSSDPRVGSGRGDSSGQGTLSSANNKTSSLSKLAATFIPVLIFLVVCF
LLFAFLRPRCRRVFAPRSIPGLREPQMPSPDLPSGWFNWILPFHRIPDTFVLNHGSLDGYFFLRFLKVLRNICLG
GCLILWPVLFPIHATGGGGLSELDLLTIGNVKDPTRLYAHAVMGWVFFGFVLYMIVRECIYYVNLRQAYLSSPYY
SQRISSRTILLTCVPKEYLDPRRLRKLYGDSVERIHIPRTTKALANLVKEREQTASRLEKAEVALILKANKARRK
QLHNTTSKPDRTSRGSSVTGSIASRHDLVKDSGDGKMVSTRGGHLVLDLPGSYIEFAPSNEKTVGDGVLKEALKP
EVKDDAVGDCDDEYTHPYGLDHDLPDVRGSVAARWIPVESRPYHRPLGNFGRRVDTIRWTRNRLRELNLQIYKMR
RQVRRGDGITLPAVFIEFDNQESAQAAHQVLAHHRPLQMSSRILGIQPGEVLWKSLRMPWWELIMRRFAILSFVC
AAVIFWSIPSAAIGLITQIDFLSRIVVLSWLKKLPDIVLGFLTGFVPSIALSLWMAAVPGMLRICGAQAGMPSVT
MVELFVQKAYFAFQVVQVFLITTLTSAASAAFTKILENPLGIKDVLAKNLPMASNFYLSYILIQCLASSGATLLQ
AFSLIRHHTLSRMSTLPRAQYKTWCKLAPARWGGIFPVFANMGVIALSYACIAPLILIFAAGGMMAMRFVWRYNI
IYVLDSAMDSKGLFYPHALLHLTIGLYLAEICLIGLFALHLAFGPLAMMVLFFIFTGLVHVSLSEAIMPLLQNLP
QTLALEEEIQKEDKAAAERAKMQATARTEDEVAPTGAASSYYDPEQAFGEEEARVDDDDEDEDDEEDDDDDEGTT
TTNDRALEGASGVKAAFGEWLKSSTRSKVRAQAESLGVTEIMSRFRQWIGQKRSDGSPSFLAKWLHPEEYEDFIA
LRRMIPPDSLPNIEYPDDHKYCDYLPPETWLPKPTLWIPRDEARVSRQEVAHTRKFTPISDIGASLDEKGHIYTC
FDQAPFDKSKVII
Coding >Ophio5|4844
ATGTCCGAGCCGCTTGACGCCCTCCAAGGCGCCAACGTCGGCCGCTGGCTCCTTCGACGCGGCTTCCTCGACATC
TTTAAAGATAGCAGCGATCCGCGCGTCGGCTCTGGTCGCGGCGATTCCTCAGGCCAAGGCACTCTCAGCTCCGCC
AACAACAAGACATCGTCTCTCAGCAAACTCGCCGCTACCTTTATTCCTGTTCTCATCTTTCTCGTCGTTTGCTTC
CTCCTCTTTGCCTTCCTCCGACCCCGATGTCGGCGCGTCTTTGCCCCGAGGTCCATTCCCGGCCTCCGGGAACCC
CAGATGCCCAGTCCCGACTTGCCATCGGGTTGGTTCAACTGGATCCTGCCCTTCCATAGGATCCCCGATACCTTT
GTCCTCAACCACGGTTCGCTCGACGGCTACTTTTTCCTTCGCTTCCTCAAGGTGCTGAGGAACATTTGTCTTGGC
GGCTGTCTCATCCTATGGCCCGTTCTCTTTCCCATCCACGCCACTGGTGGCGGCGGCCTCTCCGAGTTAGACCTG
TTGACCATTGGCAACGTCAAGGACCCGACTCGGCTATATGCTCATGCCGTCATGGGCTGGGTCTTCTTCGGTTTC
GTCCTCTACATGATTGTGCGCGAGTGTATATACTACGTCAATCTGCGCCAGGCCTACCTCTCCTCGCCCTACTAC
TCGCAGCGCATTTCCTCCAGAACCATCCTCCTAACCTGCGTGCCCAAGGAGTACCTCGACCCGCGCCGACTGCGC
AAGCTGTACGGAGACTCCGTCGAGCGCATACACATCCCGCGCACCACAAAGGCCTTGGCCAATCTGGTCAAAGAG
CGGGAGCAGACGGCATCGAGACTCGAAAAGGCAGAGGTCGCCCTGATCCTCAAAGCAAACAAGGCCCGGCGTAAA
CAGCTGCATAACACGACGTCCAAGCCCGATCGAACGTCGCGGGGGTCTTCCGTGACTGGATCCATCGCGTCGAGA
CACGACCTCGTCAAGGACAGCGGTGACGGCAAAATGGTTTCGACGCGCGGCGGTCATCTCGTCCTCGATCTGCCG
GGATCTTACATCGAGTTTGCGCCTTCGAATGAAAAGACTGTCGGTGATGGCGTCCTGAAAGAAGCCCTCAAGCCG
GAAGTCAAGGACGACGCTGTTGGAGACTGCGACGACGAATACACCCATCCCTACGGACTCGACCATGATCTCCCG
GACGTCAGAGGCTCCGTGGCCGCCAGGTGGATTCCCGTCGAGTCGCGACCTTACCACCGGCCTCTGGGAAACTTT
GGCCGCCGCGTCGACACCATTCGCTGGACTCGGAACCGGCTGCGGGAACTCAATCTTCAGATTTACAAGATGCGC
CGGCAGGTCCGCAGGGGCGACGGCATCACGCTCCCTGCCGTCTTCATCGAGTTTGACAACCAGGAGAGCGCACAG
GCGGCTCATCAGGTCCTCGCCCATCATCGCCCGCTTCAGATGTCGTCTCGCATCCTCGGCATTCAACCGGGCGAG
GTGCTGTGGAAGTCGCTGCGCATGCCCTGGTGGGAGCTCATCATGCGGAGATTTGCAATCTTGTCCTTTGTCTGC
GCCGCCGTCATTTTCTGGTCGATTCCGTCGGCCGCCATCGGCCTGATAACGCAGATTGACTTTCTGTCTCGCATC
GTCGTTCTCTCTTGGCTCAAGAAGCTTCCGGACATTGTTCTCGGCTTTCTCACGGGCTTCGTGCCGTCCATTGCC
CTGTCCCTTTGGATGGCGGCCGTGCCCGGCATGCTTCGAATCTGCGGAGCGCAAGCCGGCATGCCTTCCGTCACC
ATGGTCGAGCTCTTCGTCCAGAAGGCCTACTTTGCGTTTCAGGTGGTTCAGGTCTTCCTCATCACCACCCTCACG
TCCGCCGCTTCTGCCGCCTTTACCAAGATTCTCGAGAATCCTCTGGGCATCAAAGACGTCCTCGCCAAGAACCTC
CCCATGGCCTCCAATTTTTACCTGTCTTACATTCTCATCCAGTGTCTTGCGAGCAGCGGAGCGACGTTGCTACAG
GCCTTCTCCCTCATTCGCCATCACACCTTGTCCAGGATGTCGACGCTTCCCCGGGCGCAGTACAAGACATGGTGC
AAGCTCGCACCGGCGCGCTGGGGAGGCATTTTTCCTGTCTTTGCCAACATGGGCGTTATCGCCCTGAGCTACGCT
TGCATAGCACCCTTGATCTTAATATTTGCCGCCGGCGGCATGATGGCGATGCGCTTTGTGTGGCGATACAACATA
ATATACGTCCTCGACTCTGCAATGGACAGCAAGGGCCTTTTTTATCCGCATGCCCTGCTGCACCTCACCATCGGC
CTCTATCTTGCCGAGATTTGCCTAATTGGGCTGTTTGCCCTTCACCTTGCGTTCGGGCCCCTTGCCATGATGGTG
CTGTTTTTCATCTTCACAGGCCTGGTGCACGTCTCGCTCAGTGAAGCCATCATGCCCCTTCTACAAAATCTGCCA
CAGACGCTGGCTCTGGAAGAGGAGATACAAAAGGAGGACAAGGCTGCCGCGGAGAGGGCAAAGATGCAGGCGACG
GCGAGGACGGAAGACGAGGTGGCACCGACTGGGGCCGCAAGCAGCTACTACGACCCGGAGCAGGCATTCGGCGAG
GAGGAAGCGCGAGTCGACGATGATGATGAAGACGAAGACGACGAAGAAGACGACGACGACGACGAAGGGACGACG
ACGACAAACGACCGAGCTCTCGAGGGCGCCAGCGGTGTCAAGGCCGCCTTTGGCGAGTGGTTAAAGTCCAGTACA
CGATCCAAGGTGCGGGCGCAGGCGGAGAGCCTCGGGGTGACGGAGATTATGAGCAGATTTCGTCAATGGATCGGG
CAGAAAAGGAGCGATGGGTCGCCGAGCTTTCTAGCCAAGTGGCTGCACCCGGAAGAGTACGAGGACTTCATCGCG
CTCCGGAGGATGATACCGCCTGACAGCCTCCCCAACATTGAATATCCCGACGACCACAAGTACTGCGACTACCTG
CCGCCGGAGACGTGGTTGCCGAAGCCGACTCTCTGGATTCCGCGAGACGAAGCGCGGGTGAGCCGACAGGAGGTG
GCTCACACGAGGAAGTTTACGCCGATATCGGATATTGGGGCTTCTTTAGATGAAAAGGGGCATATATACACCTGT
TTCGACCAGGCGCCGTTTGACAAGTCAAAGGTAATCATA
Transcript >Ophio5|4844
ATGTCCGAGCCGCTTGACGCCCTCCAAGGCGCCAACGTCGGCCGCTGGCTCCTTCGACGCGGCTTCCTCGACATC
TTTAAAGATAGCAGCGATCCGCGCGTCGGCTCTGGTCGCGGCGATTCCTCAGGCCAAGGCACTCTCAGCTCCGCC
AACAACAAGACATCGTCTCTCAGCAAACTCGCCGCTACCTTTATTCCTGTTCTCATCTTTCTCGTCGTTTGCTTC
CTCCTCTTTGCCTTCCTCCGACCCCGATGTCGGCGCGTCTTTGCCCCGAGGTCCATTCCCGGCCTCCGGGAACCC
CAGATGCCCAGTCCCGACTTGCCATCGGGTTGGTTCAACTGGATCCTGCCCTTCCATAGGATCCCCGATACCTTT
GTCCTCAACCACGGTTCGCTCGACGGCTACTTTTTCCTTCGCTTCCTCAAGGTGCTGAGGAACATTTGTCTTGGC
GGCTGTCTCATCCTATGGCCCGTTCTCTTTCCCATCCACGCCACTGGTGGCGGCGGCCTCTCCGAGTTAGACCTG
TTGACCATTGGCAACGTCAAGGACCCGACTCGGCTATATGCTCATGCCGTCATGGGCTGGGTCTTCTTCGGTTTC
GTCCTCTACATGATTGTGCGCGAGTGTATATACTACGTCAATCTGCGCCAGGCCTACCTCTCCTCGCCCTACTAC
TCGCAGCGCATTTCCTCCAGAACCATCCTCCTAACCTGCGTGCCCAAGGAGTACCTCGACCCGCGCCGACTGCGC
AAGCTGTACGGAGACTCCGTCGAGCGCATACACATCCCGCGCACCACAAAGGCCTTGGCCAATCTGGTCAAAGAG
CGGGAGCAGACGGCATCGAGACTCGAAAAGGCAGAGGTCGCCCTGATCCTCAAAGCAAACAAGGCCCGGCGTAAA
CAGCTGCATAACACGACGTCCAAGCCCGATCGAACGTCGCGGGGGTCTTCCGTGACTGGATCCATCGCGTCGAGA
CACGACCTCGTCAAGGACAGCGGTGACGGCAAAATGGTTTCGACGCGCGGCGGTCATCTCGTCCTCGATCTGCCG
GGATCTTACATCGAGTTTGCGCCTTCGAATGAAAAGACTGTCGGTGATGGCGTCCTGAAAGAAGCCCTCAAGCCG
GAAGTCAAGGACGACGCTGTTGGAGACTGCGACGACGAATACACCCATCCCTACGGACTCGACCATGATCTCCCG
GACGTCAGAGGCTCCGTGGCCGCCAGGTGGATTCCCGTCGAGTCGCGACCTTACCACCGGCCTCTGGGAAACTTT
GGCCGCCGCGTCGACACCATTCGCTGGACTCGGAACCGGCTGCGGGAACTCAATCTTCAGATTTACAAGATGCGC
CGGCAGGTCCGCAGGGGCGACGGCATCACGCTCCCTGCCGTCTTCATCGAGTTTGACAACCAGGAGAGCGCACAG
GCGGCTCATCAGGTCCTCGCCCATCATCGCCCGCTTCAGATGTCGTCTCGCATCCTCGGCATTCAACCGGGCGAG
GTGCTGTGGAAGTCGCTGCGCATGCCCTGGTGGGAGCTCATCATGCGGAGATTTGCAATCTTGTCCTTTGTCTGC
GCCGCCGTCATTTTCTGGTCGATTCCGTCGGCCGCCATCGGCCTGATAACGCAGATTGACTTTCTGTCTCGCATC
GTCGTTCTCTCTTGGCTCAAGAAGCTTCCGGACATTGTTCTCGGCTTTCTCACGGGCTTCGTGCCGTCCATTGCC
CTGTCCCTTTGGATGGCGGCCGTGCCCGGCATGCTTCGAATCTGCGGAGCGCAAGCCGGCATGCCTTCCGTCACC
ATGGTCGAGCTCTTCGTCCAGAAGGCCTACTTTGCGTTTCAGGTGGTTCAGGTCTTCCTCATCACCACCCTCACG
TCCGCCGCTTCTGCCGCCTTTACCAAGATTCTCGAGAATCCTCTGGGCATCAAAGACGTCCTCGCCAAGAACCTC
CCCATGGCCTCCAATTTTTACCTGTCTTACATTCTCATCCAGTGTCTTGCGAGCAGCGGAGCGACGTTGCTACAG
GCCTTCTCCCTCATTCGCCATCACACCTTGTCCAGGATGTCGACGCTTCCCCGGGCGCAGTACAAGACATGGTGC
AAGCTCGCACCGGCGCGCTGGGGAGGCATTTTTCCTGTCTTTGCCAACATGGGCGTTATCGCCCTGAGCTACGCT
TGCATAGCACCCTTGATCTTAATATTTGCCGCCGGCGGCATGATGGCGATGCGCTTTGTGTGGCGATACAACATA
ATATACGTCCTCGACTCTGCAATGGACAGCAAGGGCCTTTTTTATCCGCATGCCCTGCTGCACCTCACCATCGGC
CTCTATCTTGCCGAGATTTGCCTAATTGGGCTGTTTGCCCTTCACCTTGCGTTCGGGCCCCTTGCCATGATGGTG
CTGTTTTTCATCTTCACAGGCCTGGTGCACGTCTCGCTCAGTGAAGCCATCATGCCCCTTCTACAAAATCTGCCA
CAGACGCTGGCTCTGGAAGAGGAGATACAAAAGGAGGACAAGGCTGCCGCGGAGAGGGCAAAGATGCAGGCGACG
GCGAGGACGGAAGACGAGGTGGCACCGACTGGGGCCGCAAGCAGCTACTACGACCCGGAGCAGGCATTCGGCGAG
GAGGAAGCGCGAGTCGACGATGATGATGAAGACGAAGACGACGAAGAAGACGACGACGACGACGAAGGGACGACG
ACGACAAACGACCGAGCTCTCGAGGGCGCCAGCGGTGTCAAGGCCGCCTTTGGCGAGTGGTTAAAGTCCAGTACA
CGATCCAAGGTGCGGGCGCAGGCGGAGAGCCTCGGGGTGACGGAGATTATGAGCAGATTTCGTCAATGGATCGGG
CAGAAAAGGAGCGATGGGTCGCCGAGCTTTCTAGCCAAGTGGCTGCACCCGGAAGAGTACGAGGACTTCATCGCG
CTCCGGAGGATGATACCGCCTGACAGCCTCCCCAACATTGAATATCCCGACGACCACAAGTACTGCGACTACCTG
CCGCCGGAGACGTGGTTGCCGAAGCCGACTCTCTGGATTCCGCGAGACGAAGCGCGGGTGAGCCGACAGGAGGTG
GCTCACACGAGGAAGTTTACGCCGATATCGGATATTGGGGCTTCTTTAGATGAAAAGGGGCATATATACACCTGT
TTCGACCAGGCGCCGTTTGACAAGTCAAAGGTAATCATATAG
Gene >Ophio5|4844
ATGTCCGAGCCGCTTGACGCCCTCCAAGGCGCCAACGTCGGCCGCTGGCTCCTTCGACGCGGCTTCCTCGACATC
TTTGTCCGTCAACATTCCCCTGCCGTCCTCGAGATTCTTATTGCTGACGTCGCTATAGAAAGATAGCAGCGATCC
GCGCGTCGGCTCTGGTCGCGGCGATTCCTCAGGCCAAGGCACTCTCAGCTCCGCCAACAACAAGACATCGTCTCT
CAGCAAACTCGCCGCTACCTTTATTCCTGTTCTCATCTTTCTCGTCGTTTGCTTCCTCCTCTTTGCCTTCCTCCG
ACCCCGATGTCGGCGCGTCTTTGCCCCGAGGTCCATTCCCGGCCTCCGGGAACCCCAGTGAGTGTCCGAAGCTCA
TGTGCTGGCATTGCGTTCGCGCCCTCATATCCGTCGCAGGATGCCCAGTCCCGACTTGCCATCGGGTTGGTTCAA
CTGGATCCTGCCCTTCCATAGGATCCCCGATACCTTTGTCCTCAACCACGGTTCGCTCGACGGCTACTTTTTCCT
TCGCTTCCTCAAGGTGCTGAGGAACATTTGTCTTGGCGGCTGTCTCATCCTATGGCCCGTTCTCTTTCCCATCCA
CGCCACTGGTGGCGGCGGCCTCTCCGAGTTAGACCTGTTGACCATTGGCAACGTCAAGGACCCGACTCGGCTATA
TGCTCATGCCGTCATGGGCTGGGTCTTCTTCGGTACGAAACCCCCTTGCGAGAGTTAGGCCTCCTTTGCTGCCTT
GCTTACCCGGCTTCAGGTTTCGTCCTCTACATGATTGTGCGCGAGTGTATATACTACGTCAATCTGCGCCAGGCC
TACCTCTCCTCGCCCTACTACTCGCAGCGCATTTCCTCCAGAACCATCCTCCTAACCTGCGTGCCCAAGGAGTAC
CTCGACCCGCGCCGACTGCGCAAGCTGTACGGAGACTCCGTCGAGCGCATACACATCCCGCGCACCACAAAGGCC
TTGGCCAATCTGGTCAAAGAGCGGGAGCAGACGGCATCGAGACTCGAAAAGGCAGAGGTCGCCCTGATCCTCAAA
GCAAACAAGGCCCGGCGTAAACAGCTGCATAACACGACGTCCAAGCCCGATCGAACGTCGCGGGGGTCTTCCGTG
ACTGGATCCATCGCGTCGAGACACGACCTCGTCAAGGACAGCGGTGACGGCAAAATGGTTTCGACGCGCGGCGGT
CATCTCGTCCTCGATCTGCCGGGATCTTACATCGAGTTTGCGCCTTCGAATGAAAAGACTGTCGGTGATGGCGTC
CTGAAAGAAGCCCTCAAGCCGGAAGTCAAGGACGACGCTGTTGGAGACTGCGACGACGAATACACCCATCCCTAC
GGACTCGACCATGATCTCCCGGACGTCAGAGGCTCCGTGGCCGCCAGGTGGATTCCCGTCGAGTCGCGACCTTAC
CACCGGCCTCTGGGAAACTTTGGCCGCCGCGTCGACACCATTCGCTGGACTCGGAACCGGCTGCGGGAACTCAAT
CTTCAGATTTACAAGATGCGCCGGCAGGTCCGCAGGGGCGACGGCATCACGCTCCCTGCCGTCTTCATCGAGTTT
GACAACCAGGAGAGCGCACAGGCGGCTCATCAGGTCCTCGCCCATCATCGCCCGCTTCAGATGTCGTCTCGCATC
CTCGGCATTCAACCGGGCGAGGTGCTGTGGAAGTCGCTGCGCATGCCCTGGTGGGAGCTCATCATGCGGAGATTT
GCAATCTTGTCCTTTGTCTGCGCCGCCGTCATTTTCTGGTCGATTCCGTCGGCCGCCATCGGCCTGATAACGCAG
ATTGACTTTCTGTCTCGCATCGTCGTTCTCTCTTGGCTCAAGAAGCTTCCGGACATTGTTCTCGGCTTTCTCACG
GGCTTCGTGCCGTCCATTGCCCTGTCCCTTTGGATGGCGGCCGTGCCCGGCATGCTTCGAAGTGCGAATCCCCTA
CCATGTCGTCGCGTACGACTGCTGACAGTGTCACAGTCTGCGGAGCGCAAGCCGGCATGCCTTCCGTCACCATGG
TCGAGCTCTTCGTCCAGAAGGCCTACTTTGCGTTTCAGGTGGTTCAGGTCTTCCTCATCACCACCCTCACGTCCG
CCGCTTCTGCCGCCTTTACCAAGATTCTCGAGAATCCTCTGGGCATCAAAGACGTCCTCGCCAAGAACCTCCCCA
TGGCCTCCAATTTTTACCTGTCTTACATTCTCATCCAGTGTCTTGCGAGCAGCGGAGCGACGTTGCTACAGGCCT
TCTCCCTCATTCGCCATCACACCTTGTCCAGGATGTCGACGCTTCCCCGGGCGCAGTACAAGACATGGTGCAAGC
TCGCACCGGCGCGCTGGGGAGGCATTTTTCCTGTCTTTGCCAACATGGGCGTTATCGGTGGGTAGCGCATCGTGC
CGTCATGCGCCGTTCGTTTGTTTGAGTCTAACTGTCGCAGCCCTGAGCTACGCTTGCATAGCACCCTTGATCTTA
ATATTTGCCGCCGGCGGCATGATGGCGATGCGCTTTGTGTGGCGATACAACATAATATACGTCCTCGACTCTGCA
ATGGACAGCAAGGGCCTTTTTTATCCGCATGCCCTGCTGCACCTCACCATCGGCCTCTATCTTGCCGAGATTTGC
CTAATTGGGCTGTTTGCCCTTCACCTTGCGTTCGGGCCCCTTGCCATGATGGTGCTGTTTTTCATCTTCACAGGC
CTGGTGCACGTCTCGCTCAGTGAAGCCATCATGCCCCTTCTACAAAATCTGCCACAGACGCTGGCTCTGGAAGAG
GAGATACAAAAGGAGGACAAGGCTGCCGCGGAGAGGGCAAAGATGCAGGCGACGGCGAGGACGGAAGACGAGGTG
GCACCGACTGGGGCCGCAAGCAGCTACTACGACCCGGAGCAGGCATTCGGCGAGGAGGAAGCGCGAGTCGACGAT
GATGATGAAGACGAAGACGACGAAGAAGACGACGACGACGACGAAGGGACGACGACGACAAACGACCGAGCTCTC
GAGGGCGCCAGCGGTGTCAAGGCCGCCTTTGGCGAGTGGTTAAAGTCCAGTACACGATCCAAGGTGCGGGCGCAG
GCGGAGAGCCTCGGGGTGACGGAGATTATGAGCAGATTTCGTCAATGGATCGGGCAGAAAAGGAGCGATGGGTCG
CCGAGCTTTCTAGCCAAGTGGCTGCACCCGGAAGAGTACGAGGACTTCATCGCGCTCCGGAGGATGATACCGCCT
GACAGCCTCCCCAACATTGAATATCCCGACGACCACAAGTACTGCGACTACCTGCCGCCGGAGACGTGGTTGCCG
AAGCCGACTCTCTGGATTCCGCGAGACGAAGCGCGGGTGAGCCGACAGGAGGTGGCTCACACGAGGAAGTTTACG
CCGATATCGGATATTGGGGCTTCTTTAGATGAAAAGGGGCATATATACACCTGTTTCGACCAGGCGCCGTTTGAC
AAGTCAAAGGTAATCATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail