Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4842
Gene name
Locationscaffold_39:10275..12138
Strand+
Gene length (bp)1863
Transcript length (bp)1863
Coding sequence length (bp)1860
Protein length (aa) 620

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.9E-10 98 513

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 58 602 4.0E-131
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 25 602 1.0E-114
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 31 608 1.0E-106
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 20 617 2.0E-96
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 20 617 5.0E-96
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39980|SIT1_YEAST Siderophore iron transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT1 PE=3 SV=1 58 602 4.0E-131
sp|P38731|ARN1_YEAST Siderophore iron transporter ARN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN1 PE=1 SV=1 25 602 1.0E-114
sp|P38724|ARN2_YEAST Siderophore iron transporter ARN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARN2 PE=3 SV=2 31 608 1.0E-106
sp|P36173|GEX2_YEAST Glutathione exchanger 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX2 PE=1 SV=1 20 617 2.0E-96
sp|P25596|GEX1_YEAST Glutathione exchanger 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEX1 PE=1 SV=4 20 617 5.0E-96
sp|Q08299|ENB1_YEAST Siderophore iron transporter ENB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENB1 PE=1 SV=1 32 616 1.0E-82
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 74 611 3.0E-62
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 65 575 1.0E-59
sp|O74395|STR1_SCHPO Siderophore iron transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str1 PE=1 SV=1 14 601 5.0E-59
sp|O94607|STR2_SCHPO Siderophore iron transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str2 PE=1 SV=1 65 614 1.0E-53
sp|Q870L2|MIRB_EMENI Siderophore iron transporter mirB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirB PE=3 SV=1 7 602 7.0E-50
sp|Q92341|STR3_SCHPO Siderophore iron transporter 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=str3 PE=1 SV=1 20 604 2.0E-39
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 140 563 1.0E-09
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 4 585 1.0E-08
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 136 381 4.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Signal peptide 0.1332 0.096 0.067 0.15 0.14 0.01 0.3887 0.8654 0.5328 0.0567

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 157 179 22
2 185 207 22
3 214 236 22
4 246 268 22
5 297 319 22
6 329 347 18
7 367 389 22
8 404 426 22
9 433 452 19
10 458 480 22
11 500 522 22
12 573 595 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup428
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1104
Ophiocordyceps australis 1348a (Ghana) OphauG2|2026
Ophiocordyceps australis map64 (Brazil) OphauB2|5381
Ophiocordyceps australis map64 (Brazil) OphauB2|549
Ophiocordyceps camponoti-floridani Ophcf2|05909
Ophiocordyceps camponoti-rufipedis Ophun1|2161
Ophiocordyceps kimflemingae Ophio5|4842 (this protein)
Ophiocordyceps subramaniannii Hirsu2|4644
Ophiocordyceps subramaniannii Hirsu2|959

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4842
MLPSRDVHEQTPLLSGKPASSTPVSSSSADPSSSESSSTPPSRQSSPSGSSSSDSDSTSSSSSLRNHSLRPPGVA
RVDAAFARLSALERTWLFGGIFLVGCAYGLESQVRVTYQPYATSSFSLHPYLSTINVLRSVVAVAVQPTAAKVAD
VVGRFEVVAAATACYVVGMAIEASAASVYTFCAGGLVYQVGYTAIVLVLEVLVADVSSMRARVFFSYVPALPFVV
NAWVGGALASAVLSVSSWRWGIAMWCLVYPLASLPLLVTLYLLDRRRAASSPAIKPAETSHAASELLQQLDVVGL
VGLVVALALVLAPLTVAGGADVSRWKSPLVLVPLVAGLALLPLFVLWERSGARMPLVPMRLLADRGVWSALAVRG
LLNLAWSVQGNYLYTVLVVAFDFSVETATRILSLFSFCGVVSGVLVGMVVYRLRRLKAVIVVGTCLFTAGLAVLY
YFPGGADLSSAAGVIAGQVLLGLASGFFAYPTQASIQASATRDHVAVMTGLYLSLYNIGSALGTSLSGALWTEAL
PPALSANLAFQPNATLARATYHSPFDVVARYPVGTEVRSAVIASYRHVQRLLCLAGIVACLPMIAFALALRNPRL
SKRQVQPDAAPPSEESVAAG
Coding >Ophio5|4842
ATGCTGCCGTCGCGGGATGTGCACGAGCAGACGCCGCTGCTGAGCGGAAAGCCTGCATCTTCGACACCAGTCTCA
TCTTCGTCTGCAGATCCATCCTCGTCAGAATCGTCGTCAACACCACCATCTCGACAATCATCGCCCTCAGGTTCA
TCCTCGTCCGACTCAGACTCTACCTCCTCCTCCTCCTCCCTTCGAAATCACTCTCTTCGCCCCCCGGGCGTCGCC
CGCGTCGATGCCGCCTTCGCCCGCCTCTCCGCCCTCGAACGAACCTGGCTCTTCGGTGGCATTTTCCTCGTCGGC
TGCGCCTACGGCCTCGAGAGCCAAGTCCGTGTTACATATCAGCCCTACGCAACATCGAGCTTCTCGCTACATCCC
TACCTATCGACCATCAACGTATTACGCAGCGTCGTCGCCGTCGCCGTTCAGCCCACGGCTGCAAAGGTGGCTGAT
GTCGTCGGCCGCTTCGAAGTCGTTGCCGCGGCTACGGCTTGCTACGTCGTCGGAATGGCCATTGAGGCTTCGGCT
GCCTCAGTCTACACTTTTTGCGCCGGTGGTCTCGTTTATCAGGTCGGTTATACTGCCATTGTTCTCGTGCTAGAG
GTGCTCGTCGCAGACGTCTCTTCGATGCGCGCTCGCGTCTTCTTCAGCTACGTGCCCGCTCTGCCCTTTGTTGTC
AACGCCTGGGTCGGAGGCGCACTCGCGTCTGCTGTGTTGTCCGTGTCTTCCTGGCGCTGGGGCATCGCCATGTGG
TGCCTCGTCTATCCGCTTGCATCGCTACCGCTGCTCGTCACCCTCTATCTGTTGGATCGTCGCCGCGCCGCCTCC
TCTCCCGCTATCAAGCCTGCCGAAACTTCTCACGCTGCTTCCGAACTCCTGCAGCAGCTCGATGTCGTCGGCCTC
GTCGGTCTCGTCGTCGCACTGGCTCTAGTCCTCGCCCCCTTGACCGTCGCTGGTGGTGCCGACGTGTCTCGCTGG
AAGAGCCCCCTCGTGCTGGTGCCTCTCGTCGCCGGTCTCGCTCTTCTACCGCTATTCGTCCTCTGGGAGCGTTCA
GGCGCCCGAATGCCTCTCGTACCGATGCGCCTGCTTGCCGACCGCGGCGTCTGGTCCGCCCTGGCCGTCCGGGGC
CTGCTCAACCTCGCCTGGTCCGTTCAGGGCAACTATCTCTACACCGTCCTCGTCGTCGCCTTCGACTTCTCCGTC
GAGACGGCCACTCGCATCCTCTCCCTCTTCTCCTTCTGCGGAGTCGTCAGTGGCGTCCTCGTTGGAATGGTCGTC
TACCGCCTGCGCCGCCTCAAGGCCGTAATCGTCGTCGGCACCTGTCTCTTCACAGCTGGCCTCGCAGTCCTCTAC
TACTTTCCCGGCGGCGCCGATCTCTCATCCGCTGCGGGCGTCATCGCCGGCCAGGTGCTCCTCGGCCTTGCCAGC
GGCTTCTTCGCCTATCCGACTCAGGCCTCCATCCAGGCATCGGCCACCCGGGATCACGTTGCCGTCATGACGGGT
CTCTACCTCTCCCTCTATAACATTGGCAGTGCTCTCGGCACCAGCCTCTCCGGCGCCCTCTGGACCGAGGCTCTA
CCGCCCGCCCTATCCGCCAACCTGGCCTTTCAACCCAACGCGACGCTGGCCCGCGCCACCTACCATTCCCCCTTT
GACGTCGTCGCCCGCTATCCCGTCGGCACTGAGGTCCGCTCCGCCGTCATTGCCAGCTACCGTCATGTCCAGCGC
CTTCTCTGCCTCGCCGGCATCGTCGCCTGCCTCCCGATGATTGCCTTTGCGCTAGCCCTGAGGAATCCCCGCCTT
TCGAAGCGGCAGGTTCAGCCGGACGCGGCCCCGCCGAGCGAGGAGAGCGTTGCGGCGGGG
Transcript >Ophio5|4842
ATGCTGCCGTCGCGGGATGTGCACGAGCAGACGCCGCTGCTGAGCGGAAAGCCTGCATCTTCGACACCAGTCTCA
TCTTCGTCTGCAGATCCATCCTCGTCAGAATCGTCGTCAACACCACCATCTCGACAATCATCGCCCTCAGGTTCA
TCCTCGTCCGACTCAGACTCTACCTCCTCCTCCTCCTCCCTTCGAAATCACTCTCTTCGCCCCCCGGGCGTCGCC
CGCGTCGATGCCGCCTTCGCCCGCCTCTCCGCCCTCGAACGAACCTGGCTCTTCGGTGGCATTTTCCTCGTCGGC
TGCGCCTACGGCCTCGAGAGCCAAGTCCGTGTTACATATCAGCCCTACGCAACATCGAGCTTCTCGCTACATCCC
TACCTATCGACCATCAACGTATTACGCAGCGTCGTCGCCGTCGCCGTTCAGCCCACGGCTGCAAAGGTGGCTGAT
GTCGTCGGCCGCTTCGAAGTCGTTGCCGCGGCTACGGCTTGCTACGTCGTCGGAATGGCCATTGAGGCTTCGGCT
GCCTCAGTCTACACTTTTTGCGCCGGTGGTCTCGTTTATCAGGTCGGTTATACTGCCATTGTTCTCGTGCTAGAG
GTGCTCGTCGCAGACGTCTCTTCGATGCGCGCTCGCGTCTTCTTCAGCTACGTGCCCGCTCTGCCCTTTGTTGTC
AACGCCTGGGTCGGAGGCGCACTCGCGTCTGCTGTGTTGTCCGTGTCTTCCTGGCGCTGGGGCATCGCCATGTGG
TGCCTCGTCTATCCGCTTGCATCGCTACCGCTGCTCGTCACCCTCTATCTGTTGGATCGTCGCCGCGCCGCCTCC
TCTCCCGCTATCAAGCCTGCCGAAACTTCTCACGCTGCTTCCGAACTCCTGCAGCAGCTCGATGTCGTCGGCCTC
GTCGGTCTCGTCGTCGCACTGGCTCTAGTCCTCGCCCCCTTGACCGTCGCTGGTGGTGCCGACGTGTCTCGCTGG
AAGAGCCCCCTCGTGCTGGTGCCTCTCGTCGCCGGTCTCGCTCTTCTACCGCTATTCGTCCTCTGGGAGCGTTCA
GGCGCCCGAATGCCTCTCGTACCGATGCGCCTGCTTGCCGACCGCGGCGTCTGGTCCGCCCTGGCCGTCCGGGGC
CTGCTCAACCTCGCCTGGTCCGTTCAGGGCAACTATCTCTACACCGTCCTCGTCGTCGCCTTCGACTTCTCCGTC
GAGACGGCCACTCGCATCCTCTCCCTCTTCTCCTTCTGCGGAGTCGTCAGTGGCGTCCTCGTTGGAATGGTCGTC
TACCGCCTGCGCCGCCTCAAGGCCGTAATCGTCGTCGGCACCTGTCTCTTCACAGCTGGCCTCGCAGTCCTCTAC
TACTTTCCCGGCGGCGCCGATCTCTCATCCGCTGCGGGCGTCATCGCCGGCCAGGTGCTCCTCGGCCTTGCCAGC
GGCTTCTTCGCCTATCCGACTCAGGCCTCCATCCAGGCATCGGCCACCCGGGATCACGTTGCCGTCATGACGGGT
CTCTACCTCTCCCTCTATAACATTGGCAGTGCTCTCGGCACCAGCCTCTCCGGCGCCCTCTGGACCGAGGCTCTA
CCGCCCGCCCTATCCGCCAACCTGGCCTTTCAACCCAACGCGACGCTGGCCCGCGCCACCTACCATTCCCCCTTT
GACGTCGTCGCCCGCTATCCCGTCGGCACTGAGGTCCGCTCCGCCGTCATTGCCAGCTACCGTCATGTCCAGCGC
CTTCTCTGCCTCGCCGGCATCGTCGCCTGCCTCCCGATGATTGCCTTTGCGCTAGCCCTGAGGAATCCCCGCCTT
TCGAAGCGGCAGGTTCAGCCGGACGCGGCCCCGCCGAGCGAGGAGAGCGTTGCGGCGGGGTGA
Gene >Ophio5|4842
ATGCTGCCGTCGCGGGATGTGCACGAGCAGACGCCGCTGCTGAGCGGAAAGCCTGCATCTTCGACACCAGTCTCA
TCTTCGTCTGCAGATCCATCCTCGTCAGAATCGTCGTCAACACCACCATCTCGACAATCATCGCCCTCAGGTTCA
TCCTCGTCCGACTCAGACTCTACCTCCTCCTCCTCCTCCCTTCGAAATCACTCTCTTCGCCCCCCGGGCGTCGCC
CGCGTCGATGCCGCCTTCGCCCGCCTCTCCGCCCTCGAACGAACCTGGCTCTTCGGTGGCATTTTCCTCGTCGGC
TGCGCCTACGGCCTCGAGAGCCAAGTCCGTGTTACATATCAGCCCTACGCAACATCGAGCTTCTCGCTACATCCC
TACCTATCGACCATCAACGTATTACGCAGCGTCGTCGCCGTCGCCGTTCAGCCCACGGCTGCAAAGGTGGCTGAT
GTCGTCGGCCGCTTCGAAGTCGTTGCCGCGGCTACGGCTTGCTACGTCGTCGGAATGGCCATTGAGGCTTCGGCT
GCCTCAGTCTACACTTTTTGCGCCGGTGGTCTCGTTTATCAGGTCGGTTATACTGCCATTGTTCTCGTGCTAGAG
GTGCTCGTCGCAGACGTCTCTTCGATGCGCGCTCGCGTCTTCTTCAGCTACGTGCCCGCTCTGCCCTTTGTTGTC
AACGCCTGGGTCGGAGGCGCACTCGCGTCTGCTGTGTTGTCCGTGTCTTCCTGGCGCTGGGGCATCGCCATGTGG
TGCCTCGTCTATCCGCTTGCATCGCTACCGCTGCTCGTCACCCTCTATCTGTTGGATCGTCGCCGCGCCGCCTCC
TCTCCCGCTATCAAGCCTGCCGAAACTTCTCACGCTGCTTCCGAACTCCTGCAGCAGCTCGATGTCGTCGGCCTC
GTCGGTCTCGTCGTCGCACTGGCTCTAGTCCTCGCCCCCTTGACCGTCGCTGGTGGTGCCGACGTGTCTCGCTGG
AAGAGCCCCCTCGTGCTGGTGCCTCTCGTCGCCGGTCTCGCTCTTCTACCGCTATTCGTCCTCTGGGAGCGTTCA
GGCGCCCGAATGCCTCTCGTACCGATGCGCCTGCTTGCCGACCGCGGCGTCTGGTCCGCCCTGGCCGTCCGGGGC
CTGCTCAACCTCGCCTGGTCCGTTCAGGGCAACTATCTCTACACCGTCCTCGTCGTCGCCTTCGACTTCTCCGTC
GAGACGGCCACTCGCATCCTCTCCCTCTTCTCCTTCTGCGGAGTCGTCAGTGGCGTCCTCGTTGGAATGGTCGTC
TACCGCCTGCGCCGCCTCAAGGCCGTAATCGTCGTCGGCACCTGTCTCTTCACAGCTGGCCTCGCAGTCCTCTAC
TACTTTCCCGGCGGCGCCGATCTCTCATCCGCTGCGGGCGTCATCGCCGGCCAGGTGCTCCTCGGCCTTGCCAGC
GGCTTCTTCGCCTATCCGACTCAGGCCTCCATCCAGGCATCGGCCACCCGGGATCACGTTGCCGTCATGACGGGT
CTCTACCTCTCCCTCTATAACATTGGCAGTGCTCTCGGCACCAGCCTCTCCGGCGCCCTCTGGACCGAGGCTCTA
CCGCCCGCCCTATCCGCCAACCTGGCCTTTCAACCCAACGCGACGCTGGCCCGCGCCACCTACCATTCCCCCTTT
GACGTCGTCGCCCGCTATCCCGTCGGCACTGAGGTCCGCTCCGCCGTCATTGCCAGCTACCGTCATGTCCAGCGC
CTTCTCTGCCTCGCCGGCATCGTCGCCTGCCTCCCGATGATTGCCTTTGCGCTAGCCCTGAGGAATCCCCGCCTT
TCGAAGCGGCAGGTTCAGCCGGACGCGGCCCCGCCGAGCGAGGAGAGCGTTGCGGCGGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail