Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4839
Gene name
Locationscaffold_39:567..2309
Strand+
Gene length (bp)1742
Transcript length (bp)1578
Coding sequence length (bp)1575
Protein length (aa) 525

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 151 173 22
2 234 256 22
3 278 300 22
4 321 343 22
5 348 367 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 42.65 23.04 62.27
CcL In ants, during behavior modification 31.12 15.39 46.86
CcD In ants, recently dead 27.20 13.65 40.74

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.196913 no
SC16a CcD 0.054298 no
CcL CcD 0.630189 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4839
MRKSGVCISRPSLLVKKKQGPPARLGPHPAMTLQEQTCIHDDRCAPSTTSDDGGAVPSRDTAVVKEEDAVVAVVD
DANKDEDEDGEGEEDDGGQDDKRCRVRLVRSSPSNSFRLAPASRLENNLPFAVGLLELANAGDFAANVWNQIPVP
VYAMVLMALGGSLALIMSLVALFDVRRAWSNVQFLRRQRRRLRLRQQSRRRQQQQQQQQQQQRLDAALRAVSFRE
LWSEIINRLAMDILMGAGALLIAAGTFMAMGGDDERVWNASNILSGYLGNTPLALFALVNSSWALFLAATAQSHV
RATRRRGMAPAAELVKRRSRNVQVFCVINGTAAVVGGVGSMLTATKWWAYVLLAPVVVSSVFCNLWWRRRVGYTR
ARGRVSAETLESDLEYAAWAEVTLREKPSPSTLTTKTYLSRLIASPTSLSDVLGWLQRHDLFPDMCVFALADASI
REALVLSTPDELDVGIAELLALPPALHPRLLIAADACVARIGRKHFRHRERYLAELLGTYCTVKTRAEDEEVGEK
Coding >Ophio5|4839
ATGAGAAAGTCTGGCGTATGTATATCTCGTCCTTCTCTACTCGTAAAGAAGAAGCAGGGTCCCCCCGCCCGCCTC
GGGCCCCATCCGGCCATGACGCTACAGGAGCAGACATGCATCCACGACGACCGCTGCGCCCCCTCGACGACCAGC
GACGACGGGGGGGCTGTGCCGAGCCGAGACACAGCCGTTGTGAAGGAGGAGGATGCCGTTGTTGCCGTGGTCGAT
GATGCCAATAAAGACGAAGACGAAGACGGAGAAGGAGAAGAAGATGACGGAGGCCAAGATGATAAAAGATGTCGC
GTTCGACTTGTCCGGTCTTCCCCTTCCAATTCCTTCCGTCTCGCGCCCGCTTCCCGACTCGAAAACAACCTCCCC
TTTGCCGTCGGTCTTCTCGAGCTCGCAAACGCAGGAGACTTCGCGGCGAACGTATGGAACCAAATCCCCGTCCCC
GTCTACGCCATGGTCTTAATGGCCCTCGGCGGCAGCCTCGCCTTGATCATGAGTCTCGTCGCACTATTCGACGTA
CGACGGGCATGGAGCAACGTACAATTCCTACGACGACAACGACGTCGACTCCGACTCCGCCAACAATCACGACGA
CGACAACAACAACAACAACAACAACAACAACAACAGCGTCTCGACGCCGCGCTCCGAGCCGTATCGTTTCGCGAA
CTGTGGAGCGAAATCATCAACCGACTCGCCATGGATATCCTCATGGGTGCCGGCGCGCTACTCATCGCGGCCGGA
ACATTCATGGCCATGGGCGGCGATGACGAACGCGTCTGGAACGCCAGTAATATCCTATCCGGCTATTTGGGAAAC
ACACCTCTTGCCCTCTTCGCCCTCGTCAACTCGTCCTGGGCGCTATTCCTGGCCGCTACCGCGCAGAGTCATGTT
CGGGCCACGAGACGGAGGGGAATGGCGCCGGCGGCTGAGCTGGTCAAGAGGAGGAGTCGGAATGTGCAGGTTTTT
TGCGTCATCAATGGCACCGCTGCTGTTGTCGGTGGCGTCGGTTCCATGTTGACGGCGACCAAGTGGTGGGCCTAT
GTTCTTCTCGCCCCCGTCGTCGTCTCATCCGTCTTTTGCAATCTTTGGTGGAGGAGACGAGTCGGTTATACCCGA
GCCCGAGGTCGCGTCTCAGCCGAAACACTCGAATCCGATCTCGAATACGCCGCCTGGGCAGAAGTTACCCTCCGC
GAGAAACCATCACCATCAACATTAACAACAAAAACATATCTATCCCGCCTCATCGCGTCACCAACTTCCCTCTCC
GACGTCCTTGGTTGGCTTCAACGCCACGACCTCTTTCCAGACATGTGCGTCTTCGCCCTCGCCGACGCCTCCATC
AGAGAAGCCCTCGTCCTTTCAACACCGGATGAGCTCGACGTCGGTATCGCCGAGTTGTTGGCTCTGCCTCCTGCG
CTGCATCCGCGTTTGCTGATAGCAGCCGACGCGTGTGTTGCGCGTATAGGCCGGAAGCATTTTCGTCATCGGGAG
AGATATCTTGCTGAGTTACTTGGCACCTATTGCACTGTCAAGACGAGGGCGGAGGATGAGGAGGTTGGAGAGAAA
Transcript >Ophio5|4839
ATGAGAAAGTCTGGCGTATGTATATCTCGTCCTTCTCTACTCGTAAAGAAGAAGCAGGGTCCCCCCGCCCGCCTC
GGGCCCCATCCGGCCATGACGCTACAGGAGCAGACATGCATCCACGACGACCGCTGCGCCCCCTCGACGACCAGC
GACGACGGGGGGGCTGTGCCGAGCCGAGACACAGCCGTTGTGAAGGAGGAGGATGCCGTTGTTGCCGTGGTCGAT
GATGCCAATAAAGACGAAGACGAAGACGGAGAAGGAGAAGAAGATGACGGAGGCCAAGATGATAAAAGATGTCGC
GTTCGACTTGTCCGGTCTTCCCCTTCCAATTCCTTCCGTCTCGCGCCCGCTTCCCGACTCGAAAACAACCTCCCC
TTTGCCGTCGGTCTTCTCGAGCTCGCAAACGCAGGAGACTTCGCGGCGAACGTATGGAACCAAATCCCCGTCCCC
GTCTACGCCATGGTCTTAATGGCCCTCGGCGGCAGCCTCGCCTTGATCATGAGTCTCGTCGCACTATTCGACGTA
CGACGGGCATGGAGCAACGTACAATTCCTACGACGACAACGACGTCGACTCCGACTCCGCCAACAATCACGACGA
CGACAACAACAACAACAACAACAACAACAACAACAGCGTCTCGACGCCGCGCTCCGAGCCGTATCGTTTCGCGAA
CTGTGGAGCGAAATCATCAACCGACTCGCCATGGATATCCTCATGGGTGCCGGCGCGCTACTCATCGCGGCCGGA
ACATTCATGGCCATGGGCGGCGATGACGAACGCGTCTGGAACGCCAGTAATATCCTATCCGGCTATTTGGGAAAC
ACACCTCTTGCCCTCTTCGCCCTCGTCAACTCGTCCTGGGCGCTATTCCTGGCCGCTACCGCGCAGAGTCATGTT
CGGGCCACGAGACGGAGGGGAATGGCGCCGGCGGCTGAGCTGGTCAAGAGGAGGAGTCGGAATGTGCAGGTTTTT
TGCGTCATCAATGGCACCGCTGCTGTTGTCGGTGGCGTCGGTTCCATGTTGACGGCGACCAAGTGGTGGGCCTAT
GTTCTTCTCGCCCCCGTCGTCGTCTCATCCGTCTTTTGCAATCTTTGGTGGAGGAGACGAGTCGGTTATACCCGA
GCCCGAGGTCGCGTCTCAGCCGAAACACTCGAATCCGATCTCGAATACGCCGCCTGGGCAGAAGTTACCCTCCGC
GAGAAACCATCACCATCAACATTAACAACAAAAACATATCTATCCCGCCTCATCGCGTCACCAACTTCCCTCTCC
GACGTCCTTGGTTGGCTTCAACGCCACGACCTCTTTCCAGACATGTGCGTCTTCGCCCTCGCCGACGCCTCCATC
AGAGAAGCCCTCGTCCTTTCAACACCGGATGAGCTCGACGTCGGTATCGCCGAGTTGTTGGCTCTGCCTCCTGCG
CTGCATCCGCGTTTGCTGATAGCAGCCGACGCGTGTGTTGCGCGTATAGGCCGGAAGCATTTTCGTCATCGGGAG
AGATATCTTGCTGAGTTACTTGGCACCTATTGCACTGTCAAGACGAGGGCGGAGGATGAGGAGGTTGGAGAGAAA
TAG
Gene >Ophio5|4839
ATGAGAAAGTCTGGCGTATGTATATCTCGTCCTTCTCTACTCGTAGTACGTATCTCGCCCATTCTTCTCGTCGTC
ATCTCTGCCAAGAAAATTCAAGACTTGGCGAAAAGAAAAAATAAAATAAAAATCCTTCTTTAATTGGGCCAAAAC
CCTAAACAAAAAGGGCTTCAATATCGATAATCGAGAACCAGCAACTGATTCCGACATAGAAGAAGAAGCAGGGTC
CCCCCGCCCGCCTCGGGCCCCATCCGGCCATGACGCTACAGGAGCAGACATGCATCCACGACGACCGCTGCGCCC
CCTCGACGACCAGCGACGACGGGGGGGCTGTGCCGAGCCGAGACACAGCCGTTGTGAAGGAGGAGGATGCCGTTG
TTGCCGTGGTCGATGATGCCAATAAAGACGAAGACGAAGACGGAGAAGGAGAAGAAGATGACGGAGGCCAAGATG
ATAAAAGATGTCGCGTTCGACTTGTCCGGTCTTCCCCTTCCAATTCCTTCCGTCTCGCGCCCGCTTCCCGACTCG
AAAACAACCTCCCCTTTGCCGTCGGTCTTCTCGAGCTCGCAAACGCAGGAGACTTCGCGGCGAACGTATGGAACC
AAATCCCCGTCCCCGTCTACGCCATGGTCTTAATGGCCCTCGGCGGCAGCCTCGCCTTGATCATGAGTCTCGTCG
CACTATTCGACGTACGACGGGCATGGAGCAACGTACAATTCCTACGACGACAACGACGTCGACTCCGACTCCGCC
AACAATCACGACGACGACAACAACAACAACAACAACAACAACAACAACAGCGTCTCGACGCCGCGCTCCGAGCCG
TATCGTTTCGCGAACTGTGGAGCGAAATCATCAACCGACTCGCCATGGATATCCTCATGGGTGCCGGCGCGCTAC
TCATCGCGGCCGGAACATTCATGGCCATGGGCGGCGATGACGAACGCGTCTGGAACGCCAGTAATATCCTATCCG
GCTATTTGGGAAACACACCTCTTGCCCTCTTCGCCCTCGTCAACTCGTCCTGGGCGCTATTCCTGGCCGCTACCG
CGCAGAGTCATGTTCGGGCCACGAGACGGAGGGGAATGGCGCCGGCGGCTGAGCTGGTCAAGAGGAGGAGTCGGA
ATGTGCAGGTTTTTTGCGTCATCAATGGCACCGCTGCTGTTGTCGGTGGCGTCGGTTCCATGTTGACGGCGACCA
AGTGGTGGGCCTATGTTCTTCTCGCCCCCGTCGTCGTCTCATCCGTCTTTTGCAATCTTTGGTGGAGGAGACGAG
TCGGTTATACCCGAGCCCGAGGTCGCGTCTCAGCCGAAACACTCGAATCCGATCTCGAATACGCCGCCTGGGCAG
AAGTTACCCTCCGCGAGAAACCATCACCATCAACATTAACAACAAAAACATATCTATCCCGCCTCATCGCGTCAC
CAACTTCCCTCTCCGACGTCCTTGGTTGGCTTCAACGCCACGACCTCTTTCCAGACATGTGCGTCTTCGCCCTCG
CCGACGCCTCCATCAGAGAAGCCCTCGTCCTTTCAACACCGGATGAGCTCGACGTCGGTATCGCCGAGTTGTTGG
CTCTGCCTCCTGCGCTGCATCCGCGTTTGCTGATAGCAGCCGACGCGTGTGTTGCGCGTATAGGCCGGAAGCATT
TTCGTCATCGGGAGAGATATCTTGCTGAGTTACTTGGCACCTATTGCACTGTCAAGACGAGGGCGGAGGATGAGG
AGGTTGGAGAGAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail