Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4837
Gene name
Locationscaffold_389:15658..18658
Strand+
Gene length (bp)3000
Transcript length (bp)2940
Coding sequence length (bp)2937
Protein length (aa) 979

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08619 Nha1_C Alkali metal cation/H+ antiporter Nha1 C terminus 4.1E-126 458 950
PF00999 Na_H_Exchanger Sodium/hydrogen exchanger family 3.2E-78 16 433

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14123|NAH2_SCHPO Probable Na(+)/H(+) antiporter C3A11.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod22 PE=1 SV=1 1 645 0.0E+00
sp|Q99271|NAH1_YEAST Na(+)/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHA1 PE=1 SV=1 3 471 0.0E+00
sp|Q99173|NAH1_ZYGRO Na(+)/H(+) antiporter 1 OS=Zygosaccharomyces rouxii GN=SOD2 PE=3 SV=1 1 715 0.0E+00
sp|O42701|NAH2_ZYGRO Na(+)/H(+) antiporter 2 OS=Zygosaccharomyces rouxii GN=SOD22 PE=3 SV=1 1 715 0.0E+00
sp|P36606|NAH_SCHPO Na(+)/H(+) antiporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod2 PE=1 SV=1 1 449 1.0E-121
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14123|NAH2_SCHPO Probable Na(+)/H(+) antiporter C3A11.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod22 PE=1 SV=1 1 645 0.0E+00
sp|Q99271|NAH1_YEAST Na(+)/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHA1 PE=1 SV=1 3 471 0.0E+00
sp|Q99173|NAH1_ZYGRO Na(+)/H(+) antiporter 1 OS=Zygosaccharomyces rouxii GN=SOD2 PE=3 SV=1 1 715 0.0E+00
sp|O42701|NAH2_ZYGRO Na(+)/H(+) antiporter 2 OS=Zygosaccharomyces rouxii GN=SOD22 PE=3 SV=1 1 715 0.0E+00
sp|P36606|NAH_SCHPO Na(+)/H(+) antiporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod2 PE=1 SV=1 1 449 1.0E-121
sp|Q99271|NAH1_YEAST Na(+)/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHA1 PE=1 SV=1 610 759 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0015385 sodium:proton antiporter activity Yes
GO:0006812 cation transport Yes
GO:0016020 membrane Yes
GO:0006814 sodium ion transport Yes
GO:0015299 solute:proton antiporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0051234 establishment of localization No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051139 metal ion:proton antiporter activity No
GO:0051179 localization No
GO:0006810 transport No
GO:0022853 active ion transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0015297 antiporter activity No
GO:0031224 intrinsic component of membrane No
GO:0015081 sodium ion transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0008150 biological_process No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015491 cation:cation antiporter activity No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0015298 solute:cation antiporter activity No
GO:0030001 metal ion transport No
GO:0005575 cellular_component No
GO:0046873 metal ion transmembrane transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0015291 secondary active transmembrane transporter activity No
GO:0006811 ion transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0005451 monovalent cation:proton antiporter activity No
GO:0015078 proton transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 13 32 19
2 102 124 22
3 134 153 19
4 174 193 19
5 203 225 22
6 246 265 19
7 293 315 22
8 327 349 22
9 362 384 22
10 405 427 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4837
MAWSHLDITEPHLVYIILGGFTSLFMLCSSFIKERMYIGEATVATLCGVIFGPHAANLIDPDKWGSVDIVTLEFS
RIVLVVQCFAVGVELPKFYMERHWRSVVLLLIPVMTFGWLIVSLFIWWMIPTLDWLDSLVVAACVTATDPVLASS
VVGKGKFAKRVPKHLRDLLSAESGCNDGMAFPFIYLSLYLIQYNKNAGKVSYYFVVYVILYECIFGAIFGFVIGY
IARHGIKYSEKHDLIDRESFLVFYFALALFCAGSGSILGLDDLLVGFTAGVGFSNDGWFGEKTEESHVSNVIDLL
LNLAYFVYFGTIIPWEQYNNGVFGVRAWRLVVIAIFVLLFRRIPIMLALKPLIPDIKNWREALFAGHFGPIGVGA
IFVAILARAELEHHESVPLPKLPPEDAENYALIYLVWPIVTFLVISSILVHGSSVAVFTLGKHINTLTLTMSYTA
APDEGTSWMNRLPRISSQSRSQAKTMSDASFDDDKEPELPPGALIPPLGFLRRQRDEDNPSRTGSRASSLVSRRR
RHRRWDDGIGPGGPVSQSAIFPSRPMLSGGTPLQEVSPPPGRENTDSTLSGGSPKEKDPERPGDEATGGERGERP
GGRAPRVEMYAEGDDIVVEDDNGEVLDVQSGHRLSEDQPRASNAGDDAAGPSDELSVWTLHGLRRKVNEMYTLEM
EKRKGKAKAQRRHEPARAYQFGNMIIVEDEDGEVVKSYQLPSQREQQEGGENSNDLIGASLKYLGLGTKARQGEK
SAEAAAEEGEAGTSASPAGRPSGWPAFSRLGAQRKTFAQQQEADDDKKIRFTIGGVGQRMTKEDFLRQVRNLDAR
TRTEVVDQSTASSAVKRLAQQGPSAQQTGGPSSKRDAHESNSSGDSRGESSGQATSGGRARPSAKAVEPTGVLSS
DETPVERRRRLAVLASQADEAEDTGETPAERRRRQAALGMEGPAAGEDSDDEGTERVPPARRGIRFAEPRRSERA
PGGS
Coding >Ophio5|4837
ATGGCTTGGTCACACCTCGACATCACCGAGCCGCACTTGGTCTATATCATCCTCGGCGGCTTCACATCCCTCTTC
ATGCTCTGCTCCTCCTTTATCAAGGAGCGCATGTACATTGGCGAGGCCACCGTTGCCACTCTCTGCGGCGTCATC
TTCGGACCTCATGCCGCCAACCTCATCGACCCGGACAAATGGGGCAGCGTCGACATCGTCACCCTCGAATTCTCC
CGCATCGTCCTCGTCGTCCAATGTTTCGCCGTCGGCGTCGAGCTGCCAAAATTCTACATGGAGAGGCACTGGCGC
TCCGTCGTACTGCTGCTCATCCCCGTCATGACCTTCGGCTGGCTCATCGTCAGCCTCTTCATTTGGTGGATGATA
CCGACGCTGGACTGGCTCGACTCGCTCGTTGTCGCCGCCTGCGTCACCGCCACCGATCCCGTCCTCGCCTCGTCC
GTCGTCGGCAAGGGCAAGTTCGCTAAGCGCGTGCCCAAGCACTTGCGCGACCTGCTCTCGGCCGAGTCCGGCTGC
AACGACGGCATGGCCTTTCCCTTCATCTATCTCTCCCTCTACCTGATCCAGTACAACAAGAACGCCGGCAAGGTC
AGCTACTATTTTGTCGTCTACGTCATCCTCTACGAGTGCATATTTGGCGCCATATTCGGCTTCGTCATCGGCTAC
ATCGCCCGCCACGGCATCAAGTACTCGGAGAAGCACGACCTTATCGACCGCGAGAGCTTCCTTGTCTTCTACTTC
GCCCTCGCCCTCTTCTGCGCCGGCTCCGGCAGCATCCTCGGCCTCGACGACCTGCTAGTCGGCTTCACCGCCGGC
GTCGGCTTCTCCAACGACGGCTGGTTTGGCGAGAAGACGGAGGAGTCGCACGTGTCAAACGTCATTGACCTGCTG
CTTAACCTGGCTTACTTTGTCTACTTTGGCACCATTATTCCCTGGGAGCAGTACAACAACGGCGTCTTCGGCGTC
CGCGCCTGGCGCCTCGTCGTCATCGCCATCTTCGTCCTGCTCTTCCGCCGCATCCCCATAATGCTGGCCCTCAAG
CCCCTGATACCGGACATCAAGAATTGGCGCGAGGCCCTGTTCGCCGGCCACTTTGGCCCCATTGGCGTCGGCGCC
ATCTTCGTCGCCATCCTCGCCCGCGCCGAGCTGGAGCACCACGAATCCGTCCCTTTGCCGAAGCTGCCACCCGAG
GATGCGGAGAATTATGCGCTCATCTACCTGGTGTGGCCCATCGTCACCTTTCTCGTCATCTCCTCCATCCTCGTC
CACGGCTCGTCCGTCGCCGTCTTTACCCTGGGCAAGCACATCAACACCCTGACGCTGACCATGTCCTACACGGCC
GCGCCTGACGAGGGCACCAGCTGGATGAACCGGCTGCCGCGCATCTCGTCTCAGTCTCGCTCCCAGGCCAAGACC
ATGTCTGACGCGTCCTTTGACGACGACAAGGAGCCGGAGCTGCCCCCAGGCGCCCTTATCCCGCCCCTGGGCTTC
CTGCGCCGCCAAAGGGACGAAGACAACCCCAGCCGCACCGGCAGCCGGGCCTCGTCTCTGGTCTCGAGGAGGCGC
AGGCACCGGAGGTGGGACGACGGCATCGGGCCGGGAGGCCCCGTCAGCCAGTCCGCCATCTTTCCCAGCCGGCCG
ATGCTCAGCGGCGGTACCCCGCTACAGGAGGTTTCCCCGCCACCCGGGCGCGAGAACACCGACTCGACGCTGTCC
GGGGGCAGCCCCAAGGAGAAAGACCCGGAGAGGCCGGGGGACGAGGCGACGGGCGGCGAGAGGGGCGAGCGACCG
GGCGGTCGAGCGCCTCGTGTGGAAATGTATGCCGAAGGAGATGACATTGTCGTCGAGGACGACAACGGCGAAGTG
CTGGACGTCCAATCGGGCCACCGACTGAGCGAGGACCAGCCGCGGGCCTCCAACGCAGGGGACGACGCCGCCGGT
CCGAGCGACGAACTCTCCGTCTGGACGCTGCACGGGCTTCGACGGAAAGTGAACGAGATGTACACGTTGGAAATG
GAGAAGCGGAAGGGCAAGGCCAAGGCTCAACGGCGTCACGAGCCGGCACGGGCTTATCAGTTTGGCAACATGATC
ATCGTCGAGGACGAAGATGGCGAGGTTGTCAAGTCATATCAGCTGCCTTCGCAAAGAGAACAACAAGAGGGTGGC
GAAAACAGCAACGACCTCATCGGGGCCAGCTTAAAGTACCTAGGTCTCGGCACGAAAGCGCGTCAAGGCGAGAAG
AGCGCGGAAGCGGCGGCAGAAGAGGGCGAGGCAGGCACGAGCGCATCCCCCGCGGGCAGGCCTTCTGGATGGCCC
GCTTTCAGCAGGTTGGGAGCGCAGAGGAAGACGTTTGCGCAGCAGCAGGAGGCGGACGATGACAAGAAGATACGA
TTTACCATTGGGGGCGTCGGGCAGCGCATGACCAAAGAGGACTTTCTCCGCCAGGTTCGGAACCTGGATGCCCGG
ACGCGCACGGAAGTGGTGGACCAGTCGACGGCATCGTCGGCGGTCAAGAGACTGGCACAGCAAGGTCCGTCGGCG
CAGCAGACGGGCGGGCCGTCTTCGAAGCGGGACGCGCACGAGAGCAACAGCAGCGGCGACAGCAGGGGAGAGAGC
AGTGGCCAGGCGACGTCGGGAGGCCGGGCGCGTCCGTCGGCCAAGGCGGTGGAACCGACCGGGGTCCTGTCGTCG
GACGAGACGCCGGTGGAGCGCCGACGACGGCTGGCGGTACTGGCGAGTCAGGCGGACGAGGCCGAGGACACGGGC
GAGACGCCGGCGGAGAGGCGGCGGCGACAAGCGGCGTTGGGCATGGAGGGGCCGGCAGCGGGAGAGGACAGCGAT
GATGAGGGAACAGAGCGGGTGCCGCCGGCTCGGAGGGGGATACGCTTTGCCGAGCCTAGGCGGAGCGAGAGAGCG
CCGGGGGGGTCA
Transcript >Ophio5|4837
ATGGCTTGGTCACACCTCGACATCACCGAGCCGCACTTGGTCTATATCATCCTCGGCGGCTTCACATCCCTCTTC
ATGCTCTGCTCCTCCTTTATCAAGGAGCGCATGTACATTGGCGAGGCCACCGTTGCCACTCTCTGCGGCGTCATC
TTCGGACCTCATGCCGCCAACCTCATCGACCCGGACAAATGGGGCAGCGTCGACATCGTCACCCTCGAATTCTCC
CGCATCGTCCTCGTCGTCCAATGTTTCGCCGTCGGCGTCGAGCTGCCAAAATTCTACATGGAGAGGCACTGGCGC
TCCGTCGTACTGCTGCTCATCCCCGTCATGACCTTCGGCTGGCTCATCGTCAGCCTCTTCATTTGGTGGATGATA
CCGACGCTGGACTGGCTCGACTCGCTCGTTGTCGCCGCCTGCGTCACCGCCACCGATCCCGTCCTCGCCTCGTCC
GTCGTCGGCAAGGGCAAGTTCGCTAAGCGCGTGCCCAAGCACTTGCGCGACCTGCTCTCGGCCGAGTCCGGCTGC
AACGACGGCATGGCCTTTCCCTTCATCTATCTCTCCCTCTACCTGATCCAGTACAACAAGAACGCCGGCAAGGTC
AGCTACTATTTTGTCGTCTACGTCATCCTCTACGAGTGCATATTTGGCGCCATATTCGGCTTCGTCATCGGCTAC
ATCGCCCGCCACGGCATCAAGTACTCGGAGAAGCACGACCTTATCGACCGCGAGAGCTTCCTTGTCTTCTACTTC
GCCCTCGCCCTCTTCTGCGCCGGCTCCGGCAGCATCCTCGGCCTCGACGACCTGCTAGTCGGCTTCACCGCCGGC
GTCGGCTTCTCCAACGACGGCTGGTTTGGCGAGAAGACGGAGGAGTCGCACGTGTCAAACGTCATTGACCTGCTG
CTTAACCTGGCTTACTTTGTCTACTTTGGCACCATTATTCCCTGGGAGCAGTACAACAACGGCGTCTTCGGCGTC
CGCGCCTGGCGCCTCGTCGTCATCGCCATCTTCGTCCTGCTCTTCCGCCGCATCCCCATAATGCTGGCCCTCAAG
CCCCTGATACCGGACATCAAGAATTGGCGCGAGGCCCTGTTCGCCGGCCACTTTGGCCCCATTGGCGTCGGCGCC
ATCTTCGTCGCCATCCTCGCCCGCGCCGAGCTGGAGCACCACGAATCCGTCCCTTTGCCGAAGCTGCCACCCGAG
GATGCGGAGAATTATGCGCTCATCTACCTGGTGTGGCCCATCGTCACCTTTCTCGTCATCTCCTCCATCCTCGTC
CACGGCTCGTCCGTCGCCGTCTTTACCCTGGGCAAGCACATCAACACCCTGACGCTGACCATGTCCTACACGGCC
GCGCCTGACGAGGGCACCAGCTGGATGAACCGGCTGCCGCGCATCTCGTCTCAGTCTCGCTCCCAGGCCAAGACC
ATGTCTGACGCGTCCTTTGACGACGACAAGGAGCCGGAGCTGCCCCCAGGCGCCCTTATCCCGCCCCTGGGCTTC
CTGCGCCGCCAAAGGGACGAAGACAACCCCAGCCGCACCGGCAGCCGGGCCTCGTCTCTGGTCTCGAGGAGGCGC
AGGCACCGGAGGTGGGACGACGGCATCGGGCCGGGAGGCCCCGTCAGCCAGTCCGCCATCTTTCCCAGCCGGCCG
ATGCTCAGCGGCGGTACCCCGCTACAGGAGGTTTCCCCGCCACCCGGGCGCGAGAACACCGACTCGACGCTGTCC
GGGGGCAGCCCCAAGGAGAAAGACCCGGAGAGGCCGGGGGACGAGGCGACGGGCGGCGAGAGGGGCGAGCGACCG
GGCGGTCGAGCGCCTCGTGTGGAAATGTATGCCGAAGGAGATGACATTGTCGTCGAGGACGACAACGGCGAAGTG
CTGGACGTCCAATCGGGCCACCGACTGAGCGAGGACCAGCCGCGGGCCTCCAACGCAGGGGACGACGCCGCCGGT
CCGAGCGACGAACTCTCCGTCTGGACGCTGCACGGGCTTCGACGGAAAGTGAACGAGATGTACACGTTGGAAATG
GAGAAGCGGAAGGGCAAGGCCAAGGCTCAACGGCGTCACGAGCCGGCACGGGCTTATCAGTTTGGCAACATGATC
ATCGTCGAGGACGAAGATGGCGAGGTTGTCAAGTCATATCAGCTGCCTTCGCAAAGAGAACAACAAGAGGGTGGC
GAAAACAGCAACGACCTCATCGGGGCCAGCTTAAAGTACCTAGGTCTCGGCACGAAAGCGCGTCAAGGCGAGAAG
AGCGCGGAAGCGGCGGCAGAAGAGGGCGAGGCAGGCACGAGCGCATCCCCCGCGGGCAGGCCTTCTGGATGGCCC
GCTTTCAGCAGGTTGGGAGCGCAGAGGAAGACGTTTGCGCAGCAGCAGGAGGCGGACGATGACAAGAAGATACGA
TTTACCATTGGGGGCGTCGGGCAGCGCATGACCAAAGAGGACTTTCTCCGCCAGGTTCGGAACCTGGATGCCCGG
ACGCGCACGGAAGTGGTGGACCAGTCGACGGCATCGTCGGCGGTCAAGAGACTGGCACAGCAAGGTCCGTCGGCG
CAGCAGACGGGCGGGCCGTCTTCGAAGCGGGACGCGCACGAGAGCAACAGCAGCGGCGACAGCAGGGGAGAGAGC
AGTGGCCAGGCGACGTCGGGAGGCCGGGCGCGTCCGTCGGCCAAGGCGGTGGAACCGACCGGGGTCCTGTCGTCG
GACGAGACGCCGGTGGAGCGCCGACGACGGCTGGCGGTACTGGCGAGTCAGGCGGACGAGGCCGAGGACACGGGC
GAGACGCCGGCGGAGAGGCGGCGGCGACAAGCGGCGTTGGGCATGGAGGGGCCGGCAGCGGGAGAGGACAGCGAT
GATGAGGGAACAGAGCGGGTGCCGCCGGCTCGGAGGGGGATACGCTTTGCCGAGCCTAGGCGGAGCGAGAGAGCG
CCGGGGGGGTCATAG
Gene >Ophio5|4837
ATGGCTTGGTCACACCTCGACATCACCGAGCCGCACTTGGTCTATATCATCCTCGGCGGCTTCACATCCCTCTTC
ATGCTCTGCTCCTCCTTTATCAAGGAGCGCATGTACATTGGCGAGGCCACCGTTGCCACTCTCTGCGGCGTCATC
TTCGGACCTCATGCCGCCAACCTCATCGACCCGGACAAATGGGGCAGCGTCGACATCGTCACCCTCGAATTCTCC
CGCATCGTCCTCGTCGTCCAATGTTTCGCCGTCGGCGTCGAGCTGCCAAAATTCTACATGGAGAGGCACTGGCGC
TCCGTCGTACTGCTGCTCATCCCCGTCATGACCTTCGGCTGGCTCATCGTCAGCCTCTTCATTTGGTGGATGATA
CCGACGCTGGACTGGCTCGACTCGCTCGTTGTCGCCGCCTGCGTCACCGCCACCGATCCCGTCCTCGCCTCGTCC
GTCGTCGGCAAGGGCAAGTTCGCTAAGCGCGTGCCCAAGCACTTGCGCGACCTGCTCTCGGCCGAGTCCGGCTGC
AACGACGGCATGGCCTTTCCCTTCATCTATCTCTCCCTCTACCTGATCCAGTACAACAAGAACGCCGGCAAGGTC
AGCTACTATTTTGTCGTCTACGTCATCCTCTACGAGTGCATATTTGGCGCCATATTCGGCTTCGTCATCGGCTAC
ATCGCCCGCCACGGCATCAAGTACTCGGAGAAGCACGACCTTATCGACCGCGAGAGCTTCCTTGTCTTCTACTTC
GCCCTCGCCCTCTTCTGCGCCGGCTCCGGCAGCATCCTCGGCCTCGACGACCTGCTAGTCGGCTTCACCGCCGGC
GTCGGCTTCTCCAACGACGGCTGGTTTGGCGAGAAGACGGAGGAGTCGCACGTGTCAAACGTCATTGACCTGCTG
CTTAACCTGGCTTACTTTGTCTACTTTGGCACCATTATTCCCTGGGAGCAGTACAACAACGGCGTCTTCGGCGTC
CGCGCCTGGCGCCTCGTCGTCATCGCCATCTTCGTCCTGCTCTTCCGCCGCATCCCCATAATGCTGGCCCTCAAG
CCCCTGATACCGGACATCAAGAATTGGCGCGAGGCCCTGTTCGCCGGCCACTTTGGCCCCATTGGCGTCGGCGCC
ATCTTCGTCGCCATCCTCGCCCGCGCCGAGCTGGAGCACCACGAATCCGTCCCTTTGCCGAAGCTGCCACCCGAG
GATGCGGAGAATTATGCGCTCATCTACCTGGTGTGGCCCATCGTCACCTTTCTCGTCATCTCCTCCATCCTCGTC
CACGGCTCGTCCGTCGCCGTCTTTACCCTGGGCAAGCACATCAACACCCTGACGCTGACCATGTCCTACACGGCC
GCGCCTGACGAGGGCACCAGCTGGATGAACCGGCTGCCGCGCATCTCGTCTCAGTCTCGCTCCCAGGCCAAGACC
ATGTCTGACGCGTCCTTTGACGACGACAAGGAGCCGGAGCTGCCCCCAGGCGCCCTTATCCCGCCCCTGGGCTTC
CTGCGCCGCCAAAGGGACGAAGACAACCCCAGCCGCACCGGCAGCCGGGCCTCGTCTCTGGTCTCGAGGAGGCGC
AGGCACCGGAGGTGGGACGACGGCATCGGGCCGGGAGGCCCCGTCAGCCAGTCCGCCATCTTTCCCAGCCGGCCG
ATGCTCAGCGGCGGTACCCCGCTACAGGAGGTTTCCCCGCCACCCGGGCGCGAGAACACCGACTCGACGCTGTCC
GGGGGCAGCCCCAAGGAGAAAGACCCGGAGAGGCCGGGGGACGAGGCGACGGGCGGCGAGAGGGGCGAGCGACCG
GGCGGTCGAGCGCCTCGTGTGGAAATGTATGCCGAAGGAGATGACATTGTCGTCGAGGACGACAACGGCGAAGTG
CTGGACGTCCAATCGGGCCACCGACTGAGCGAGGACCAGCCGCGGGCCTCCAACGCAGGGGACGACGCCGCCGGT
CCGAGCGACGAACTCTCCGTCTGGACGCTGCACGGGCTTCGACGGAAAGTGAACGAGATGTACACGTTGGAAATG
GAGAAGCGGAAGGGCAAGGCCAAGGCTCAACGGCGTCACGAGCCGGCACGGGCTTATCAGTTTGGCAACATGGTG
CGTCCCCCTACCCTGACCTTGTTCTCTCCGTTGAAGCTAACTGGGCGCCGTGCGCAGATCATCGTCGAGGACGAA
GATGGCGAGGTTGTCAAGTCATATCAGCTGCCTTCGCAAAGAGAACAACAAGAGGGTGGCGAAAACAGCAACGAC
CTCATCGGGGCCAGCTTAAAGTACCTAGGTCTCGGCACGAAAGCGCGTCAAGGCGAGAAGAGCGCGGAAGCGGCG
GCAGAAGAGGGCGAGGCAGGCACGAGCGCATCCCCCGCGGGCAGGCCTTCTGGATGGCCCGCTTTCAGCAGGTTG
GGAGCGCAGAGGAAGACGTTTGCGCAGCAGCAGGAGGCGGACGATGACAAGAAGATACGATTTACCATTGGGGGC
GTCGGGCAGCGCATGACCAAAGAGGACTTTCTCCGCCAGGTTCGGAACCTGGATGCCCGGACGCGCACGGAAGTG
GTGGACCAGTCGACGGCATCGTCGGCGGTCAAGAGACTGGCACAGCAAGGTCCGTCGGCGCAGCAGACGGGCGGG
CCGTCTTCGAAGCGGGACGCGCACGAGAGCAACAGCAGCGGCGACAGCAGGGGAGAGAGCAGTGGCCAGGCGACG
TCGGGAGGCCGGGCGCGTCCGTCGGCCAAGGCGGTGGAACCGACCGGGGTCCTGTCGTCGGACGAGACGCCGGTG
GAGCGCCGACGACGGCTGGCGGTACTGGCGAGTCAGGCGGACGAGGCCGAGGACACGGGCGAGACGCCGGCGGAG
AGGCGGCGGCGACAAGCGGCGTTGGGCATGGAGGGGCCGGCAGCGGGAGAGGACAGCGATGATGAGGGAACAGAG
CGGGTGCCGCCGGCTCGGAGGGGGATACGCTTTGCCGAGCCTAGGCGGAGCGAGAGAGCGCCGGGGGGGTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail