Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4835
Gene name
Locationscaffold_389:11150..11913
Strand+
Gene length (bp)763
Transcript length (bp)630
Coding sequence length (bp)627
Protein length (aa) 209

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00188 CAP Cysteine-rich secretory protein family 5.0E-10 40 146

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P47032|PRY1_YEAST Protein PRY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY1 PE=1 SV=1 51 137 2.0E-24
sp|P36110|PRY2_YEAST Protein PRY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY2 PE=1 SV=1 49 139 2.0E-23
sp|P47033|PRY3_YEAST Cell wall protein PRY3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY3 PE=1 SV=1 31 146 2.0E-22
sp|Q59ZX3|RBE1_CANAL Repressed by EFG1 protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBE1 PE=1 SV=1 31 146 1.0E-17
sp|Q5AB49|Y6200_CANAL Probable pathogenesis-related protein CaO19.6200 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.13580 PE=2 SV=1 30 136 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P47032|PRY1_YEAST Protein PRY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY1 PE=1 SV=1 51 137 2.0E-24
sp|P36110|PRY2_YEAST Protein PRY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY2 PE=1 SV=1 49 139 2.0E-23
sp|P47033|PRY3_YEAST Cell wall protein PRY3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY3 PE=1 SV=1 31 146 2.0E-22
sp|Q59ZX3|RBE1_CANAL Repressed by EFG1 protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBE1 PE=1 SV=1 31 146 1.0E-17
sp|Q5AB49|Y6200_CANAL Probable pathogenesis-related protein CaO19.6200 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.13580 PE=2 SV=1 30 136 2.0E-15
sp|P35792|PR12_HORVU Pathogenesis-related protein PRB1-2 OS=Hordeum vulgare PE=2 SV=1 36 146 2.0E-15
sp|Q05968|PR1_HORVU Pathogenesis-related protein 1 OS=Hordeum vulgare PE=2 SV=1 36 146 5.0E-15
sp|Q59WG5|Y2336_CANAL Probable pathogenesis-related protein CaO19.2336 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.2336 PE=2 SV=1 30 138 6.0E-14
sp|Q40374|PR1_MEDTR Pathogenesis-related protein PR-1 OS=Medicago truncatula GN=PR-1 PE=2 SV=1 21 146 7.0E-14
sp|Q59PV6|PRY1_CANAL Secreted protein PRY1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRY1 PE=1 SV=1 28 136 9.0E-14
sp|Q08697|PR1A_SOLLC Pathogenesis-related protein 1A1 OS=Solanum lycopersicum PE=2 SV=1 43 146 1.0E-13
sp|Q00008|PRMS_MAIZE Pathogenesis-related protein PRMS OS=Zea mays GN=PRMS PE=2 SV=1 2 146 2.0E-13
sp|Q9ZNS4|PRB1_ARATH Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=PRB1 PE=2 SV=1 26 138 2.0E-13
sp|P33154|PR1_ARATH Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=At2g14610 PE=1 SV=1 6 138 3.0E-13
sp|P35793|PR13_HORVU Pathogenesis-related protein PRB1-3 OS=Hordeum vulgare PE=2 SV=1 53 146 5.0E-13
sp|P11670|PRB1_TOBAC Basic form of pathogenesis-related protein 1 OS=Nicotiana tabacum PE=3 SV=1 5 146 1.0E-11
sp|P09042|PR1C_TOBAC Pathogenesis-related protein 1C OS=Nicotiana tabacum PE=2 SV=3 43 138 1.0E-10
sp|P07053|PR1B_TOBAC Pathogenesis-related protein 1B OS=Nicotiana tabacum PE=2 SV=1 43 138 3.0E-10
sp|Q41359|PR1_SAMNI Pathogenesis-related protein PR-1 type OS=Sambucus nigra PE=2 SV=1 43 146 5.0E-10
sp|P08299|PR1A_TOBAC Pathogenesis-related protein 1A OS=Nicotiana tabacum PE=1 SV=1 43 138 5.0E-10
sp|Q5AB48|RBT4_CANAL Secreted protein RBT4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBT4 PE=1 SV=2 22 167 1.0E-08
sp|Q41495|ST14_SOLTU STS14 protein OS=Solanum tuberosum GN=STS14 PE=2 SV=1 43 147 2.0E-06
sp|Q04108|PR04_SOLLC Pathogenesis-related leaf protein 4 OS=Solanum lycopersicum PE=2 SV=1 23 146 2.0E-06
sp|Q9CYL5|GAPR1_MOUSE Golgi-associated plant pathogenesis-related protein 1 OS=Mus musculus GN=Glipr2 PE=1 SV=3 29 133 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4835
MNKAFLLFALAAAAAAAGSDPNFWWLDEQAFESAVISTTSHYRGEYGAGLVRWNATLAAFASWYLGNYNCAFRHS
GGPFGENMAFGYPTPAVSVAAWGNEGVQYDYGHPGYSPATGHFTQLVWKSTTDIGCARRWCGSQMQWLFTCYAIQ
GRAGALATLWREEKAYVRGRLSLGTLLGGLHVFATTSLTEKMGADCLGRAVIWCHDDLL
Coding >Ophio5|4835
ATGAACAAGGCCTTTCTGCTATTCGCCCTGGCCGCCGCCGCCGCCGCCGCCGGCTCAGACCCCAACTTCTGGTGG
CTGGACGAGCAAGCCTTCGAATCGGCCGTGATCAGCACGACGAGCCACTACCGCGGCGAGTATGGCGCAGGCCTC
GTTCGGTGGAACGCGACGCTGGCGGCGTTCGCATCGTGGTATCTAGGCAACTACAACTGCGCGTTCCGACACTCG
GGAGGCCCGTTTGGCGAGAATATGGCCTTTGGCTACCCGACGCCGGCCGTCAGCGTGGCGGCCTGGGGCAACGAG
GGCGTGCAATACGATTACGGCCATCCCGGGTACAGCCCTGCGACGGGGCACTTTACGCAGCTGGTTTGGAAGTCG
ACGACGGATATCGGTTGCGCGAGGAGGTGGTGTGGCAGTCAGATGCAGTGGCTTTTCACGTGCTATGCCATCCAA
GGACGAGCAGGAGCCCTCGCCACACTCTGGAGGGAGGAGAAGGCATACGTACGCGGTCGTCTGTCGCTTGGAACG
CTTCTTGGAGGTTTGCATGTCTTTGCTACCACATCTCTGACTGAGAAGATGGGTGCCGATTGCCTTGGACGTGCA
GTTATATGGTGCCACGATGACTTGCTG
Transcript >Ophio5|4835
ATGAACAAGGCCTTTCTGCTATTCGCCCTGGCCGCCGCCGCCGCCGCCGCCGGCTCAGACCCCAACTTCTGGTGG
CTGGACGAGCAAGCCTTCGAATCGGCCGTGATCAGCACGACGAGCCACTACCGCGGCGAGTATGGCGCAGGCCTC
GTTCGGTGGAACGCGACGCTGGCGGCGTTCGCATCGTGGTATCTAGGCAACTACAACTGCGCGTTCCGACACTCG
GGAGGCCCGTTTGGCGAGAATATGGCCTTTGGCTACCCGACGCCGGCCGTCAGCGTGGCGGCCTGGGGCAACGAG
GGCGTGCAATACGATTACGGCCATCCCGGGTACAGCCCTGCGACGGGGCACTTTACGCAGCTGGTTTGGAAGTCG
ACGACGGATATCGGTTGCGCGAGGAGGTGGTGTGGCAGTCAGATGCAGTGGCTTTTCACGTGCTATGCCATCCAA
GGACGAGCAGGAGCCCTCGCCACACTCTGGAGGGAGGAGAAGGCATACGTACGCGGTCGTCTGTCGCTTGGAACG
CTTCTTGGAGGTTTGCATGTCTTTGCTACCACATCTCTGACTGAGAAGATGGGTGCCGATTGCCTTGGACGTGCA
GTTATATGGTGCCACGATGACTTGCTGTGA
Gene >Ophio5|4835
ATGAACAAGGCCTTTCTGCTATTCGCCCTGGCCGCCGCCGCCGCCGCCGCCGGCTCAGACCCCAACTTCTGGTGG
CTGGACGAGCAAGCCTTCGAATCGGCCGTGATCAGCACGACGAGCCACTACCGCGGCGAGTATGGCGCAGGCCTC
GTTCGGTGGAACGCGACGCTGGCGGCGTTCGCATCGTGGTATCTAGGCAACTACAACTGCGCGTTCCGACACTCG
GGAGGCCCGTTTGGCGAGAATATGGCCTTTGGCTACCCGACGCCGGCCGTCAGCGTGGCGGCCTGGGGCAACGAG
GGCGTGCAATACGATTACGGCCATCCCGGGTACAGCCCTGCGACGGGGCACTTTACGCAGCTGGTTTGGAAGTCG
ACGACGGATATCGGTTGCGCGAGGAGGTGGTGTGGCAGTCAGATGCAGTGGCTTTTCACGTGTGAGTATTGGCCC
AGAGGGAATGTTCTCGGGCAGTTTGAGCAGAATGTTGGGTGGCCTTGAGCAGGCTATGCCATCCAAGGACGAGCA
GGAGCCCTCGCCACACTCTGGAGGGAGGAGAAGGCATACGTACGCGGTAAGCCACTTCGTCTGCTTCCCATCACC
GTCTTTGATCTAGGCTTAGCTGATACGCTCGATGGAAGGTCGTCTGTCGCTTGGAACGCTTCTTGGAGGTTTGCA
TGTCTTTGCTACCACATCTCTGACTGAGAAGATGGGTGCCGATTGCCTTGGACGTGCAGTTATATGGTGCCACGA
TGACTTGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail