Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4832
Gene name
Locationscaffold_389:1385..4978
Strand-
Gene length (bp)3593
Transcript length (bp)3411
Coding sequence length (bp)3408
Protein length (aa) 1136

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 5.1E-10 522 853
PF00096 zf-C2H2 Zinc finger, C2H2 type 3.5E-03 61 83
PF00096 zf-C2H2 Zinc finger, C2H2 type 2.4E-04 89 112

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46974|RSF2_YEAST Respiration factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSF2 PE=1 SV=1 54 149 1.0E-23
sp|Q04545|TDA9_YEAST Probable transcription factor TDA9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA9 PE=1 SV=1 54 112 4.0E-21
sp|Q5AF56|ADR1_CANAL Transcriptional regulator ADR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADR1 PE=2 SV=1 57 127 2.0E-20
sp|P78871|RST2_SCHPO Zinc finger protein rst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rst2 PE=2 SV=2 24 117 5.0E-19
sp|P07248|ADR1_YEAST Regulatory protein ADR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADR1 PE=1 SV=2 57 146 8.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46974|RSF2_YEAST Respiration factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSF2 PE=1 SV=1 54 149 1.0E-23
sp|Q04545|TDA9_YEAST Probable transcription factor TDA9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA9 PE=1 SV=1 54 112 4.0E-21
sp|Q5AF56|ADR1_CANAL Transcriptional regulator ADR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADR1 PE=2 SV=1 57 127 2.0E-20
sp|P78871|RST2_SCHPO Zinc finger protein rst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rst2 PE=2 SV=2 24 117 5.0E-19
sp|P07248|ADR1_YEAST Regulatory protein ADR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADR1 PE=1 SV=2 57 146 8.0E-18
sp|Q5A4K7|TRY5_CANAL Transcriptional regulator of yeast form adherence 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRY5 PE=3 SV=1 59 124 1.0E-15
sp|P46974|RSF2_YEAST Respiration factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSF2 PE=1 SV=1 507 1122 3.0E-15
sp|Q5ANC8|TRY4_CANAL Transcriptional regulator of yeast form adherence 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRY4 PE=2 SV=1 63 115 1.0E-12
sp|Q5AMH6|CAS5_CANAL Cell wall integrity transcriptional regulator CAS5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAS5 PE=3 SV=1 31 112 1.0E-12
sp|Q04545|TDA9_YEAST Probable transcription factor TDA9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA9 PE=1 SV=1 510 1126 4.0E-12
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 59 145 6.0E-12
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 108 7.0E-12
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 57 117 1.0E-11
sp|P27705|MIG1_YEAST Regulatory protein MIG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG1 PE=1 SV=1 54 130 1.0E-11
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 108 3.0E-11
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 59 145 5.0E-11
sp|P53243|YG2A_YEAST Zinc finger protein YGR067C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR067C PE=3 SV=2 59 119 6.0E-11
sp|Q05620|CREA_ASPNG DNA-binding protein creA OS=Aspergillus niger GN=creA PE=3 SV=1 54 124 8.0E-11
sp|B0XSK6|CREA_ASPFC Probable DNA-binding protein creA OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=creA PE=3 SV=1 53 124 1.0E-10
sp|P50898|MIG1_KLULA Regulatory protein MIG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MIG1 PE=3 SV=1 56 109 1.0E-10
sp|Q4X0Z3|CREA_ASPFU Probable DNA-binding protein creA OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=creA PE=3 SV=1 53 124 1.0E-10
sp|A1C6L9|CREA_ASPCL Probable DNA-binding protein creA OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=creA PE=3 SV=1 53 124 1.0E-10
sp|A1DH89|CREA_NEOFI Probable DNA-binding protein creA OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=creA PE=3 SV=1 53 124 1.0E-10
sp|Q01981|CREA_EMENI DNA-binding protein creA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=creA PE=1 SV=1 54 124 1.0E-10
sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 43 107 3.0E-10
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 117 3.0E-10
sp|O94130|CREA_BOTFU DNA-binding protein creA OS=Botryotinia fuckeliana GN=creA PE=3 SV=1 54 128 3.0E-10
sp|Q9HFS2|CREA_COCCA DNA-binding protein creA OS=Cochliobolus carbonum GN=CREA PE=2 SV=1 53 120 4.0E-10
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 59 145 5.0E-10
sp|Q59U10|BCR1_CANAL Biofilm and cell wall regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BCR1 PE=1 SV=1 66 116 6.0E-10
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 59 113 6.0E-10
sp|A2QCJ9|CREA_ASPNC Probable DNA-binding protein creA OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=creA PE=3 SV=1 54 124 6.0E-10
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 59 113 6.0E-10
sp|Q9P889|CREA_ASPOR DNA-binding protein creA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=creA PE=3 SV=1 54 124 6.0E-10
sp|B8NGC8|CREA_ASPFN Probable DNA-binding protein creA OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=creA PE=3 SV=1 54 124 6.0E-10
sp|O94166|CREA_ASPAC DNA-binding protein creA OS=Aspergillus aculeatus GN=creA PE=3 SV=1 54 124 7.0E-10
sp|O59958|CRE1_NEUCR DNA-binding protein cre-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cre-1 PE=2 SV=2 53 124 8.0E-10
sp|P53035|MIG2_YEAST Regulatory protein MIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG2 PE=1 SV=1 45 107 1.0E-09
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 117 2.0E-09
sp|O74252|STE12_EMENI Transcription factor steA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=steA PE=2 SV=1 61 113 2.0E-09
sp|P18736|ZG71_XENLA Gastrula zinc finger protein XlCGF71.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 108 2.0E-09
sp|O14335|SCR1_SCHPO DNA-binding protein scr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scr1 PE=3 SV=1 56 107 2.0E-09
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 119 2.0E-09
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 59 125 2.0E-09
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 59 125 2.0E-09
sp|Q9P7D9|RSV1_SCHPO Zinc finger protein rsv1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsv1 PE=2 SV=1 63 107 2.0E-09
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 107 3.0E-09
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 116 3.0E-09
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 4 117 3.0E-09
sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2 59 113 3.0E-09
sp|Q6NZQ6|ZN740_MOUSE Zinc finger protein 740 OS=Mus musculus GN=Znf740 PE=1 SV=1 59 119 3.0E-09
sp|Q9Y7G2|MIG1_CANAX Regulatory protein MIG1 OS=Candida albicans GN=MIG1 PE=3 SV=1 52 126 3.0E-09
sp|O94131|CREA_GIBFU DNA-binding protein creA OS=Gibberella fujikuroi GN=CREA PE=3 SV=1 58 124 3.0E-09
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 59 119 3.0E-09
sp|Q62445|SP4_MOUSE Transcription factor Sp4 OS=Mus musculus GN=Sp4 PE=2 SV=2 59 113 4.0E-09
sp|Q8SUR9|Z856_ENCCU Zinc finger C2H2 protein ECU08_0560 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0560 PE=3 SV=2 57 115 4.0E-09
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 59 167 4.0E-09
sp|Q12132|USV1_YEAST Nutrient and stress factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=USV1 PE=1 SV=1 66 112 4.0E-09
sp|P18736|ZG71_XENLA Gastrula zinc finger protein XlCGF71.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 108 6.0E-09
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 59 117 6.0E-09
sp|P33749|MSN4_YEAST Zinc finger protein MSN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSN4 PE=1 SV=1 9 107 7.0E-09
sp|Q9UTS5|ZAS1_SCHPO Zinc finger protein zas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zas1 PE=2 SV=1 66 112 8.0E-09
sp|P18732|ZG64_XENLA Gastrula zinc finger protein XlCGF64.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 108 8.0E-09
sp|Q8BZ34|ZN641_MOUSE Zinc finger protein 641 OS=Mus musculus GN=Znf641 PE=2 SV=1 58 128 8.0E-09
sp|P18743|ZO2_XENLA Oocyte zinc finger protein XlCOF2 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 112 9.0E-09
sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens GN=SP3 PE=1 SV=3 59 113 1.0E-08
sp|Q96N77|ZN641_HUMAN Zinc finger protein 641 OS=Homo sapiens GN=ZNF641 PE=1 SV=2 58 107 1.0E-08
sp|Q7L3S4|ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens GN=ZNF771 PE=1 SV=1 43 107 1.0E-08
sp|Q90WR8|SP3_CHICK Transcription factor Sp3 OS=Gallus gallus GN=SP3 PE=1 SV=1 59 113 1.0E-08
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 59 112 1.0E-08
sp|Q59RR3|MNL1_CANAL Transcriptional regulator MNL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNL1 PE=3 SV=1 55 113 1.0E-08
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 59 113 1.0E-08
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 59 113 2.0E-08
sp|O70494|SP3_MOUSE Transcription factor Sp3 OS=Mus musculus GN=Sp3 PE=1 SV=2 59 113 2.0E-08
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 59 113 2.0E-08
sp|Q9GZX5|ZN350_HUMAN Zinc finger protein 350 OS=Homo sapiens GN=ZNF350 PE=1 SV=3 59 192 2.0E-08
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 117 2.0E-08
sp|P52288|MIG1_KLUMA Regulatory protein MIG1 OS=Kluyveromyces marxianus GN=MIG1 PE=3 SV=1 54 109 2.0E-08
sp|O95125|ZN202_HUMAN Zinc finger protein 202 OS=Homo sapiens GN=ZNF202 PE=1 SV=4 59 109 2.0E-08
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 59 109 3.0E-08
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 119 3.0E-08
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 59 109 3.0E-08
sp|O57415|RREB1_CHICK Ras-responsive element-binding protein 1 OS=Gallus gallus GN=RREB1 PE=2 SV=2 54 152 3.0E-08
sp|P39943|MIG3_YEAST Transcription corepressor MIG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG3 PE=1 SV=1 52 107 3.0E-08
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 59 109 3.0E-08
sp|Q9BUG6|ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens GN=ZSCAN5A PE=2 SV=1 59 117 3.0E-08
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 59 109 3.0E-08
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 59 113 3.0E-08
sp|A8MWA4|Z705E_HUMAN Putative zinc finger protein 705E OS=Homo sapiens GN=ZNF705E PE=3 SV=1 59 109 3.0E-08
sp|O95125|ZN202_HUMAN Zinc finger protein 202 OS=Homo sapiens GN=ZNF202 PE=1 SV=4 59 125 4.0E-08
sp|P14404|EVI1_MOUSE MDS1 and EVI1 complex locus protein EVI1 OS=Mus musculus GN=Mecom PE=1 SV=1 59 173 4.0E-08
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 59 113 4.0E-08
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 59 113 4.0E-08
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 59 109 4.0E-08
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 59 113 4.0E-08
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 59 113 4.0E-08
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 59 132 4.0E-08
sp|Q3UH06|RREB1_MOUSE Ras-responsive element-binding protein 1 OS=Mus musculus GN=Rreb1 PE=1 SV=2 53 113 4.0E-08
sp|A6NDX5|ZN840_HUMAN Putative zinc finger protein 840 OS=Homo sapiens GN=ZNF840P PE=5 SV=5 59 109 5.0E-08
sp|Q0IHB8|OSR2B_XENLA Protein odd-skipped-related 2-B OS=Xenopus laevis GN=osr2-b PE=2 SV=1 59 118 5.0E-08
sp|Q32NK7|OSR2A_XENLA Protein odd-skipped-related 2-A OS=Xenopus laevis GN=osr2-a PE=2 SV=1 59 118 5.0E-08
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 59 109 5.0E-08
sp|P18742|ZO19_XENLA Oocyte zinc finger protein XlCOF19 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 117 5.0E-08
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 59 117 5.0E-08
sp|P18734|ZG67_XENLA Gastrula zinc finger protein XlCGF67.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 54 119 5.0E-08
sp|Q8N0Y2|ZN444_HUMAN Zinc finger protein 444 OS=Homo sapiens GN=ZNF444 PE=1 SV=1 53 109 5.0E-08
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 59 117 6.0E-08
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 59 117 6.0E-08
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 117 6.0E-08
sp|P17030|ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens GN=ZNF25 PE=2 SV=2 59 109 6.0E-08
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 59 118 6.0E-08
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 59 121 6.0E-08
sp|A8MVS1|Z705F_HUMAN Zinc finger protein 705F OS=Homo sapiens GN=ZNF705F PE=3 SV=1 59 109 6.0E-08
sp|P0CH99|Z705D_HUMAN Zinc finger protein 705D OS=Homo sapiens GN=ZNF705D PE=2 SV=1 59 109 6.0E-08
sp|Q8WTR7|ZN473_HUMAN Zinc finger protein 473 OS=Homo sapiens GN=ZNF473 PE=1 SV=1 59 117 6.0E-08
sp|P0CI00|Z705B_HUMAN Putative zinc finger protein 705B OS=Homo sapiens GN=ZNF705B PE=5 SV=1 59 109 6.0E-08
sp|Q24266|BTD_DROME Transcription factor btd OS=Drosophila melanogaster GN=btd PE=2 SV=1 59 109 6.0E-08
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 59 113 6.0E-08
sp|Q8NDX6|ZN740_HUMAN Zinc finger protein 740 OS=Homo sapiens GN=ZNF740 PE=1 SV=1 59 109 6.0E-08
sp|Q4R6J4|ZN684_MACFA Zinc finger protein 684 OS=Macaca fascicularis GN=ZNF684 PE=2 SV=1 63 117 6.0E-08
sp|Q96N77|ZN641_HUMAN Zinc finger protein 641 OS=Homo sapiens GN=ZNF641 PE=1 SV=2 59 125 7.0E-08
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 59 144 7.0E-08
sp|Q9ULD5|ZN777_HUMAN Zinc finger protein 777 OS=Homo sapiens GN=ZNF777 PE=1 SV=2 62 120 7.0E-08
sp|Q92766|RREB1_HUMAN Ras-responsive element-binding protein 1 OS=Homo sapiens GN=RREB1 PE=1 SV=3 53 113 7.0E-08
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 59 144 7.0E-08
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 59 112 7.0E-08
sp|Q8BZ34|ZN641_MOUSE Zinc finger protein 641 OS=Mus musculus GN=Znf641 PE=2 SV=1 59 118 8.0E-08
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 59 117 8.0E-08
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 59 117 8.0E-08
sp|Q6ZN79|Z705A_HUMAN Zinc finger protein 705A OS=Homo sapiens GN=ZNF705A PE=2 SV=1 59 109 8.0E-08
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 59 112 8.0E-08
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 59 109 8.0E-08
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 59 112 8.0E-08
sp|P18712|ZG16_XENLA Gastrula zinc finger protein XlCGF16.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 60 116 8.0E-08
sp|Q00453|RGM1_YEAST Probable transcription repressor protein RGM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGM1 PE=1 SV=2 66 112 9.0E-08
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 59 109 9.0E-08
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 59 193 9.0E-08
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 59 109 9.0E-08
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 59 112 9.0E-08
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 121 1.0E-07
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 108 1.0E-07
sp|P18736|ZG71_XENLA Gastrula zinc finger protein XlCGF71.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 63 119 1.0E-07
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 59 117 1.0E-07
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 59 109 1.0E-07
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 59 112 1.0E-07
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 59 112 1.0E-07
sp|Q4VA44|ZN664_MOUSE Zinc finger protein 664 OS=Mus musculus GN=Znf664 PE=2 SV=2 59 117 1.0E-07
sp|P39956|RPH1_YEAST DNA damage-responsive transcriptional repressor RPH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPH1 PE=1 SV=1 57 110 1.0E-07
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 59 112 1.0E-07
sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 59 121 1.0E-07
sp|Q8N3J9|ZN664_HUMAN Zinc finger protein 664 OS=Homo sapiens GN=ZNF664 PE=2 SV=1 59 117 1.0E-07
sp|Q5T5D7|ZN684_HUMAN Zinc finger protein 684 OS=Homo sapiens GN=ZNF684 PE=2 SV=1 63 117 1.0E-07
sp|Q9US36|KLF1_SCHPO Zinc finger protein klf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=klf1 PE=2 SV=1 66 112 1.0E-07
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 59 109 1.0E-07
sp|Q10076|HSR1_SCHPO Hydrogen peroxide stress regulator 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsr1 PE=2 SV=1 62 117 1.0E-07
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 59 112 1.0E-07
sp|A1XSY8|EGR2_PIG E3 SUMO-protein ligase EGR2 OS=Sus scrofa GN=EGR2 PE=2 SV=1 59 112 1.0E-07
sp|Q60493|ZN664_CAVPO Zinc finger protein 664 OS=Cavia porcellus GN=ZNF664 PE=2 SV=1 59 117 1.0E-07
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 59 167 1.0E-07
sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 59 109 1.0E-07
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 59 167 1.0E-07
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 59 117 1.0E-07
sp|Q99LI5|ZN281_MOUSE Zinc finger protein 281 OS=Mus musculus GN=Znf281 PE=1 SV=1 59 117 1.0E-07
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 57 126 1.0E-07
sp|P54785|MOT3_YEAST Transcriptional activator/repressor MOT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT3 PE=1 SV=1 12 112 1.0E-07
sp|Q6GQR8|ZN329_MOUSE Zinc finger protein 329 OS=Mus musculus GN=Znf329 PE=1 SV=2 59 167 1.0E-07
sp|Q3MJ62|ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens GN=ZSCAN23 PE=2 SV=1 59 112 1.0E-07
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 59 112 1.0E-07
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 59 168 1.0E-07
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 59 168 1.0E-07
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 107 2.0E-07
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 117 2.0E-07
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 121 2.0E-07
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 117 2.0E-07
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 59 107 2.0E-07
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 59 107 2.0E-07
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 59 107 2.0E-07
sp|Q4R6J4|ZN684_MACFA Zinc finger protein 684 OS=Macaca fascicularis GN=ZNF684 PE=2 SV=1 59 112 2.0E-07
sp|Q5T5D7|ZN684_HUMAN Zinc finger protein 684 OS=Homo sapiens GN=ZNF684 PE=2 SV=1 59 112 2.0E-07
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 60 108 2.0E-07
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 60 108 2.0E-07
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 59 109 2.0E-07
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 59 107 2.0E-07
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 59 117 2.0E-07
sp|Q9Y2X9|ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens GN=ZNF281 PE=1 SV=1 59 117 2.0E-07
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 117 2.0E-07
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 63 108 2.0E-07
sp|P18746|ZO26_XENLA Oocyte zinc finger protein XlCOF26 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 109 2.0E-07
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 59 119 2.0E-07
sp|P10074|ZBT48_HUMAN Zinc finger and BTB domain-containing protein 48 OS=Homo sapiens GN=ZBTB48 PE=1 SV=2 60 110 2.0E-07
sp|Q5R633|ZBT48_PONAB Zinc finger and BTB domain-containing protein 48 OS=Pongo abelii GN=ZBTB48 PE=2 SV=1 60 110 2.0E-07
sp|Q1H9T6|ZBT48_MOUSE Zinc finger and BTB domain-containing protein 48 OS=Mus musculus GN=Zbtb48 PE=1 SV=1 60 108 2.0E-07
sp|Q8N8C0|ZN781_HUMAN Zinc finger protein 781 OS=Homo sapiens GN=ZNF781 PE=2 SV=1 59 117 2.0E-07
sp|Q16670|ZSC26_HUMAN Zinc finger and SCAN domain-containing protein 26 OS=Homo sapiens GN=ZSCAN26 PE=1 SV=2 59 193 2.0E-07
sp|P08152|EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus GN=Egr2 PE=1 SV=3 59 112 2.0E-07
sp|O73692|EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix coturnix japonica GN=EGR1 PE=3 SV=1 59 112 2.0E-07
sp|O73691|EGR1_CHICK Early growth response protein 1 (Fragment) OS=Gallus gallus GN=EGR1 PE=3 SV=1 59 112 2.0E-07
sp|Q61624|ZN148_MOUSE Zinc finger protein 148 OS=Mus musculus GN=Znf148 PE=1 SV=2 58 117 2.0E-07
sp|Q9UQR1|ZN148_HUMAN Zinc finger protein 148 OS=Homo sapiens GN=ZNF148 PE=1 SV=2 58 117 2.0E-07
sp|Q3Y4E1|ZN148_BOVIN Zinc finger protein 148 OS=Bos taurus GN=ZNF148 PE=2 SV=1 58 117 2.0E-07
sp|P51774|EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus GN=Egr2 PE=2 SV=2 59 112 2.0E-07
sp|Q62806|ZN148_RAT Zinc finger protein 148 OS=Rattus norvegicus GN=Znf148 PE=1 SV=1 58 117 2.0E-07
sp|Q5R782|ZN148_PONAB Zinc finger protein 148 OS=Pongo abelii GN=ZNF148 PE=2 SV=1 58 117 2.0E-07
sp|P52744|ZN138_HUMAN Zinc finger protein 138 OS=Homo sapiens GN=ZNF138 PE=1 SV=2 59 108 2.0E-07
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 59 109 2.0E-07
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 59 107 2.0E-07
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 58 109 2.0E-07
sp|P33748|MSN2_YEAST Zinc finger protein MSN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSN2 PE=1 SV=1 59 107 2.0E-07
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN=ZNF664 PE=2 SV=1 59 109 2.0E-07
sp|Q15973|ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens GN=ZNF124 PE=1 SV=2 59 117 2.0E-07
sp|Q98T94|GLIS2_XENLA Zinc finger protein GLIS2 OS=Xenopus laevis GN=glis2 PE=2 SV=1 59 109 2.0E-07
sp|Q9Z1D9|ZN394_MOUSE Zinc finger protein 394 OS=Mus musculus GN=Znf394 PE=2 SV=3 59 167 2.0E-07
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 59 117 2.0E-07
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 59 109 2.0E-07
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 59 117 2.0E-07
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 59 109 2.0E-07
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 117 3.0E-07
sp|P18734|ZG67_XENLA Gastrula zinc finger protein XlCGF67.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 119 3.0E-07
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 59 108 3.0E-07
sp|B2KFW1|ZSC20_MOUSE Zinc finger and SCAN domain-containing protein 20 OS=Mus musculus GN=Zscan20 PE=2 SV=2 59 121 3.0E-07
sp|Q25515|KRUP_MANSE Protein krueppel (Fragment) OS=Manduca sexta GN=Kr PE=2 SV=1 59 122 3.0E-07
sp|Q4VBD9|GZF1_MOUSE GDNF-inducible zinc finger protein 1 OS=Mus musculus GN=Gzf1 PE=1 SV=2 59 117 3.0E-07
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 59 113 3.0E-07
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 59 113 3.0E-07
sp|Q01792|KRUP_BRACO Protein krueppel (Fragment) OS=Bradysia coprophila GN=Kr PE=3 SV=1 59 117 3.0E-07
sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=1 SV=1 59 117 3.0E-07
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 59 109 3.0E-07
sp|P20385|CF2_DROME Chorion transcription factor Cf2 OS=Drosophila melanogaster GN=Cf2 PE=2 SV=3 16 107 3.0E-07
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 59 202 3.0E-07
sp|P08042|ZFP1_MOUSE Zinc finger protein 1 OS=Mus musculus GN=Zfp1 PE=2 SV=3 59 109 3.0E-07
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 59 112 3.0E-07
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 59 117 3.0E-07
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 59 129 3.0E-07
sp|P18726|ZG5A_XENLA Gastrula zinc finger protein XlCGF51.1A (Fragment) OS=Xenopus laevis PE=3 SV=1 62 119 3.0E-07
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 63 117 3.0E-07
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 59 109 4.0E-07
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 59 109 4.0E-07
sp|P18712|ZG16_XENLA Gastrula zinc finger protein XlCGF16.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 109 4.0E-07
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 63 117 4.0E-07
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 57 117 4.0E-07
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 63 117 4.0E-07
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 57 117 4.0E-07
sp|Q9QZ48|ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus GN=Zbtb7a PE=1 SV=1 59 141 4.0E-07
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 59 117 4.0E-07
sp|Q9Z2K3|ZN394_RAT Zinc finger protein 394 OS=Rattus norvegicus GN=Znf394 PE=2 SV=1 59 192 4.0E-07
sp|P07247|KRUP_DROME Protein krueppel OS=Drosophila melanogaster GN=Kr PE=1 SV=2 62 117 4.0E-07
sp|Q03112|EVI1_HUMAN MDS1 and EVI1 complex locus protein EVI1 OS=Homo sapiens GN=MECOM PE=1 SV=2 59 173 4.0E-07
sp|Q03833|GIS1_YEAST Transcriptional activator/repressor GIS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS1 PE=1 SV=1 55 110 4.0E-07
sp|B7Z6K7|ZN814_HUMAN Putative uncharacterized zinc finger protein 814 OS=Homo sapiens GN=ZNF814 PE=1 SV=2 59 167 4.0E-07
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 59 117 4.0E-07
sp|P18739|ZO10_XENLA Oocyte zinc finger protein XlCOF10 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 109 4.0E-07
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 117 4.0E-07
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 59 125 4.0E-07
sp|P30373|CKR1_CHICK Zinc finger protein CKR1 OS=Gallus gallus PE=2 SV=1 59 141 4.0E-07
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 59 117 4.0E-07
sp|O43829|ZBT14_HUMAN Zinc finger and BTB domain-containing protein 14 OS=Homo sapiens GN=ZBTB14 PE=1 SV=2 59 119 4.0E-07
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 57 117 5.0E-07
sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 117 5.0E-07
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 59 168 5.0E-07
sp|P18720|ZG42_XENLA Gastrula zinc finger protein XlCGF42.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 129 5.0E-07
sp|P18720|ZG42_XENLA Gastrula zinc finger protein XlCGF42.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 117 5.0E-07
sp|O88939|ZBT7A_MOUSE Zinc finger and BTB domain-containing protein 7A OS=Mus musculus GN=Zbtb7a PE=1 SV=2 59 125 5.0E-07
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 59 112 5.0E-07
sp|Q6ZNH5|ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens GN=ZNF497 PE=2 SV=2 59 167 5.0E-07
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 59 117 5.0E-07
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 59 121 5.0E-07
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 59 112 5.0E-07
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 63 117 5.0E-07
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 59 121 5.0E-07
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 117 5.0E-07
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 59 121 5.0E-07
sp|Q5HY98|ZN766_HUMAN Zinc finger protein 766 OS=Homo sapiens GN=ZNF766 PE=2 SV=1 59 117 5.0E-07
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 57 109 6.0E-07
sp|P18732|ZG64_XENLA Gastrula zinc finger protein XlCGF64.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 108 6.0E-07
sp|Q61624|ZN148_MOUSE Zinc finger protein 148 OS=Mus musculus GN=Znf148 PE=1 SV=2 59 114 6.0E-07
sp|Q5R782|ZN148_PONAB Zinc finger protein 148 OS=Pongo abelii GN=ZNF148 PE=2 SV=1 59 113 6.0E-07
sp|O95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens GN=ZBTB7A PE=1 SV=1 59 125 6.0E-07
sp|Q5RAU9|ZN131_PONAB Zinc finger protein 131 OS=Pongo abelii GN=ZNF131 PE=2 SV=1 59 107 6.0E-07
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 59 108 6.0E-07
sp|Q08376|ZBT14_MOUSE Zinc finger and BTB domain-containing protein 14 OS=Mus musculus GN=Zbtb14 PE=2 SV=1 59 119 6.0E-07
sp|Q9ER74|SALL1_MOUSE Sal-like protein 1 OS=Mus musculus GN=Sall1 PE=1 SV=1 58 130 6.0E-07
sp|Q14119|VEZF1_HUMAN Vascular endothelial zinc finger 1 OS=Homo sapiens GN=VEZF1 PE=1 SV=2 61 107 6.0E-07
sp|P18716|ZG28_XENLA Gastrula zinc finger protein XlCGF28.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 109 6.0E-07
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 59 112 6.0E-07
sp|Q92010|ZBT14_CHICK Zinc finger and BTB domain-containing protein 14 OS=Gallus gallus GN=ZBTB14 PE=2 SV=1 59 112 6.0E-07
sp|O95863|SNAI1_HUMAN Zinc finger protein SNAI1 OS=Homo sapiens GN=SNAI1 PE=1 SV=2 60 109 6.0E-07
sp|Q9UQR1|ZN148_HUMAN Zinc finger protein 148 OS=Homo sapiens GN=ZNF148 PE=1 SV=2 59 113 7.0E-07
sp|Q3Y4E1|ZN148_BOVIN Zinc finger protein 148 OS=Bos taurus GN=ZNF148 PE=2 SV=1 59 113 7.0E-07
sp|Q62806|ZN148_RAT Zinc finger protein 148 OS=Rattus norvegicus GN=Znf148 PE=1 SV=1 59 113 7.0E-07
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 59 168 7.0E-07
sp|Q6P2A1|PRDM9_DANRE Histone-lysine N-methyltransferase PRDM9 OS=Danio rerio GN=prdm9 PE=2 SV=1 61 108 7.0E-07
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 59 113 7.0E-07
sp|Q96EG3|ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens GN=ZNF837 PE=2 SV=2 59 121 7.0E-07
sp|P18740|ZO14_XENLA Oocyte zinc finger protein XlCOF14 (Fragment) OS=Xenopus laevis PE=3 SV=1 63 108 7.0E-07
sp|B7ZRM8|EVI1B_XENLA MDS1 and EVI1 complex locus protein EVI1-B OS=Xenopus laevis GN=mecom-b PE=2 SV=1 59 163 7.0E-07
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 59 109 7.0E-07
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 59 109 7.0E-07
sp|Q7Z3I7|ZN572_HUMAN Zinc finger protein 572 OS=Homo sapiens GN=ZNF572 PE=1 SV=1 59 107 7.0E-07
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 59 113 7.0E-07
sp|Q9HAZ2|PRD16_HUMAN PR domain zinc finger protein 16 OS=Homo sapiens GN=PRDM16 PE=1 SV=3 59 120 7.0E-07
sp|Q6P9G9|ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens GN=ZNF449 PE=1 SV=3 43 117 7.0E-07
sp|Q5RC79|ZFP1_PONAB Zinc finger protein 1 homolog OS=Pongo abelii GN=ZFP1 PE=2 SV=1 59 167 7.0E-07
sp|P18718|ZG3_XENLA Gastrula zinc finger protein xLCGF3.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 130 8.0E-07
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 54 110 8.0E-07
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 54 110 8.0E-07
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 117 8.0E-07
sp|P18742|ZO19_XENLA Oocyte zinc finger protein XlCOF19 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 119 8.0E-07
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 59 109 8.0E-07
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 60 117 8.0E-07
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 60 108 8.0E-07
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 59 113 8.0E-07
sp|P52739|ZN131_HUMAN Zinc finger protein 131 OS=Homo sapiens GN=ZNF131 PE=1 SV=2 59 107 8.0E-07
sp|Q9NSC2|SALL1_HUMAN Sal-like protein 1 OS=Homo sapiens GN=SALL1 PE=1 SV=2 58 130 8.0E-07
sp|Q6P2D0|ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens GN=ZFP1 PE=1 SV=2 59 167 8.0E-07
sp|A1YEQ3|ZN449_GORGO Zinc finger protein 449 OS=Gorilla gorilla gorilla GN=ZNF449 PE=3 SV=1 43 117 8.0E-07
sp|A1YFW6|ZN449_PANPA Zinc finger protein 449 OS=Pan paniscus GN=ZNF449 PE=3 SV=1 43 117 8.0E-07
sp|P18741|ZO15_XENLA Oocyte zinc finger protein XlCOF15 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 117 8.0E-07
sp|A2T6W2|ZN449_PANTR Zinc finger protein 449 OS=Pan troglodytes GN=ZNF449 PE=3 SV=1 43 117 8.0E-07
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 59 117 8.0E-07
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 59 109 8.0E-07
sp|Q6AZW8|ZN660_HUMAN Zinc finger protein 660 OS=Homo sapiens GN=ZNF660 PE=1 SV=1 59 119 8.0E-07
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 59 167 8.0E-07
sp|Q9VI93|RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster GN=rn PE=1 SV=2 59 117 8.0E-07
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 59 125 9.0E-07
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 59 117 9.0E-07
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 59 117 9.0E-07
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 54 110 9.0E-07
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 54 110 9.0E-07
sp|P20385|CF2_DROME Chorion transcription factor Cf2 OS=Drosophila melanogaster GN=Cf2 PE=2 SV=3 59 112 9.0E-07
sp|P19538|CI_DROME Transcriptional activator cubitus interruptus OS=Drosophila melanogaster GN=ci PE=1 SV=2 59 117 9.0E-07
sp|Q8TDD2|SP7_HUMAN Transcription factor Sp7 OS=Homo sapiens GN=SP7 PE=1 SV=1 59 165 9.0E-07
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 59 184 9.0E-07
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 59 184 9.0E-07
sp|A2A935|PRD16_MOUSE PR domain zinc finger protein 16 OS=Mus musculus GN=Prdm16 PE=1 SV=1 59 120 9.0E-07
sp|A0MS83|ZN148_DANRE Zinc finger protein 148 OS=Danio rerio GN=znf148 PE=2 SV=2 59 113 9.0E-07
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 58 123 9.0E-07
sp|Q09838|PRZ1_SCHPO Transcriptional regulator prz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prz1 PE=1 SV=1 59 109 9.0E-07
sp|P18737|ZG8_XENLA Gastrula zinc finger protein XlCGF8.2DB (Fragment) OS=Xenopus laevis PE=3 SV=1 59 117 9.0E-07
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 59 117 1.0E-06
sp|P18750|ZO61_XENLA Oocyte zinc finger protein XlCOF6.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 119 1.0E-06
sp|P18736|ZG71_XENLA Gastrula zinc finger protein XlCGF71.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 57 119 1.0E-06
sp|Q68DI1|ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens GN=ZNF776 PE=1 SV=2 31 167 1.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 59 117 1.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 59 109 1.0E-06
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 112 1.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 59 109 1.0E-06
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 59 109 1.0E-06
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 54 110 1.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 59 117 1.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 59 107 1.0E-06
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 54 110 1.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 59 117 1.0E-06
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 63 112 1.0E-06
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 59 117 1.0E-06
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 59 110 1.0E-06
sp|Q5T5D7|ZN684_HUMAN Zinc finger protein 684 OS=Homo sapiens GN=ZNF684 PE=2 SV=1 59 108 1.0E-06
sp|Q99LI5|ZN281_MOUSE Zinc finger protein 281 OS=Mus musculus GN=Znf281 PE=1 SV=1 57 109 1.0E-06
sp|Q6PGE4|ZF316_MOUSE Zinc finger protein 316 OS=Mus musculus GN=Znf316 PE=2 SV=1 59 109 1.0E-06
sp|Q9Y2X9|ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens GN=ZNF281 PE=1 SV=1 57 109 1.0E-06
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 59 122 1.0E-06
sp|A6NFI3|ZN316_HUMAN Zinc finger protein 316 OS=Homo sapiens GN=ZNF316 PE=1 SV=1 59 109 1.0E-06
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 21 108 1.0E-06
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 59 122 1.0E-06
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 59 109 1.0E-06
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 63 112 1.0E-06
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 56 117 1.0E-06
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 117 1.0E-06
sp|P18729|ZG57_XENLA Gastrula zinc finger protein XlCGF57.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 117 1.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 59 117 1.0E-06
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 60 117 1.0E-06
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 59 109 1.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 59 109 1.0E-06
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 59 117 1.0E-06
sp|A0MS83|ZN148_DANRE Zinc finger protein 148 OS=Danio rerio GN=znf148 PE=2 SV=2 58 117 1.0E-06
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 59 184 1.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 59 109 1.0E-06
sp|Q9Y2P0|ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens GN=ZNF835 PE=2 SV=2 59 117 1.0E-06
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 59 109 1.0E-06
sp|P18733|ZG66_XENLA Gastrula zinc finger protein XlCGF66.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 62 119 1.0E-06
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 59 109 1.0E-06
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 59 109 1.0E-06
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 59 168 1.0E-06
sp|Q01871|KRUP_EUSPL Protein krueppel (Fragment) OS=Euscelis plebejus GN=Kr PE=3 SV=1 59 117 1.0E-06
sp|P16372|ZFP58_MOUSE Zinc finger protein 58 OS=Mus musculus GN=Zfp58 PE=2 SV=2 59 108 1.0E-06
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 59 117 1.0E-06
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 59 117 1.0E-06
sp|Q6ZN11|ZN793_HUMAN Zinc finger protein 793 OS=Homo sapiens GN=ZNF793 PE=2 SV=2 53 109 1.0E-06
sp|Q01779|KRUP_MUSDO Protein krueppel (Fragment) OS=Musca domestica GN=Kr PE=3 SV=1 59 117 1.0E-06
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 59 110 1.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 59 162 1.0E-06
sp|Q8IWY8|ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens GN=ZSCAN29 PE=1 SV=2 59 107 1.0E-06
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 59 109 1.0E-06
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 59 108 1.0E-06
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 59 109 1.0E-06
sp|Q9Y2L8|ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens GN=ZKSCAN5 PE=1 SV=1 59 121 1.0E-06
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 59 117 1.0E-06
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 59 112 1.0E-06
sp|Q49A33|Z876P_HUMAN Putative zinc finger protein 876 OS=Homo sapiens GN=ZNF876P PE=5 SV=3 43 117 1.0E-06
sp|A2T7D2|ZKSC5_PANTR Zinc finger protein with KRAB and SCAN domains 5 OS=Pan troglodytes GN=ZKSCAN5 PE=3 SV=1 59 121 1.0E-06
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 25 117 1.0E-06
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 59 109 1.0E-06
sp|Q9H5H4|ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens GN=ZNF768 PE=1 SV=2 59 119 1.0E-06
sp|P97469|SNAI2_MOUSE Zinc finger protein SNAI2 OS=Mus musculus GN=Snai2 PE=1 SV=1 60 109 1.0E-06
sp|Q10096|YAOH_SCHPO Zinc finger protein C11D3.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.17 PE=1 SV=1 52 113 1.0E-06
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 59 117 1.0E-06
sp|Q9H7R0|ZN442_HUMAN Zinc finger protein 442 OS=Homo sapiens GN=ZNF442 PE=2 SV=1 59 109 1.0E-06
sp|P41995|ODD1_CAEEL Zinc finger protein odd-1 OS=Caenorhabditis elegans GN=odd-1 PE=2 SV=2 22 117 1.0E-06
sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=1 SV=3 56 117 1.0E-06
sp|P18713|ZG17_XENLA Gastrula zinc finger protein XlCGF17.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 107 2.0E-06
sp|P18732|ZG64_XENLA Gastrula zinc finger protein XlCGF64.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 108 2.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 59 108 2.0E-06
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 59 108 2.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 59 107 2.0E-06
sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=3 59 109 2.0E-06
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 59 117 2.0E-06
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 59 109 2.0E-06
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 47 107 2.0E-06
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 59 109 2.0E-06
sp|Q15973|ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens GN=ZNF124 PE=1 SV=2 63 117 2.0E-06
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 59 117 2.0E-06
sp|Q28151|OZF_BOVIN Zinc finger protein OZF OS=Bos taurus GN=ZNF146 PE=3 SV=1 60 108 2.0E-06
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 117 2.0E-06
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 59 108 2.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 59 109 2.0E-06
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 59 117 2.0E-06
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 59 107 2.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 59 167 2.0E-06
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 59 117 2.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 24 167 2.0E-06
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 59 109 2.0E-06
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 59 108 2.0E-06
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 59 118 2.0E-06
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 59 109 2.0E-06
sp|Q91VW9|ZKSC3_MOUSE Zinc finger protein with KRAB and SCAN domains 3 OS=Mus musculus GN=Zkscan3 PE=1 SV=1 56 110 2.0E-06
sp|P86413|OSR1_XENLA Protein odd-skipped-related 1 OS=Xenopus laevis GN=osr1 PE=2 SV=1 59 108 2.0E-06
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 59 109 2.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 59 117 2.0E-06
sp|Q66JF8|OSR1_XENTR Protein odd-skipped-related 1 OS=Xenopus tropicalis GN=osr1 PE=2 SV=1 59 108 2.0E-06
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 59 117 2.0E-06
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 59 143 2.0E-06
sp|P16415|ZN823_HUMAN Zinc finger protein 823 OS=Homo sapiens GN=ZNF823 PE=2 SV=2 59 117 2.0E-06
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 59 109 2.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 59 117 2.0E-06
sp|P47806|GLI1_MOUSE Zinc finger protein GLI1 OS=Mus musculus GN=Gli1 PE=1 SV=4 59 117 2.0E-06
sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 30 107 2.0E-06
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 59 117 2.0E-06
sp|Q62981|ZN260_RAT Zinc finger protein 260 OS=Rattus norvegicus GN=Znf260 PE=1 SV=1 59 108 2.0E-06
sp|Q642B2|ZN672_RAT Zinc finger protein 672 OS=Rattus norvegicus GN=Znf672 PE=2 SV=1 59 107 2.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 59 117 2.0E-06
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 59 117 2.0E-06
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 59 109 2.0E-06
sp|Q02035|KRUP_PSYCI Protein krueppel (Fragment) OS=Psychoda cinerea GN=Kr PE=3 SV=1 59 117 2.0E-06
sp|P31507|KRUP_APIME Protein krueppel (Fragment) OS=Apis mellifera GN=Kr PE=3 SV=1 59 117 2.0E-06
sp|Q8VDL9|GLIS2_MOUSE Zinc finger protein GLIS2 OS=Mus musculus GN=Glis2 PE=1 SV=1 59 109 2.0E-06
sp|Q5A4H5|CRZ1_CANAL Transcriptional regulator CRZ1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRZ1 PE=1 SV=1 58 113 2.0E-06
sp|Q9BZE0|GLIS2_HUMAN Zinc finger protein GLIS2 OS=Homo sapiens GN=GLIS2 PE=1 SV=2 59 109 2.0E-06
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 59 112 2.0E-06
sp|Q96N95|ZN396_HUMAN Zinc finger protein 396 OS=Homo sapiens GN=ZNF396 PE=1 SV=2 59 117 2.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 41 167 2.0E-06
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 8 107 2.0E-06
sp|A2T6E3|ZSC12_MACNE Zinc finger and SCAN domain-containing protein 12 OS=Macaca nemestrina GN=ZSCAN12 PE=3 SV=1 21 108 2.0E-06
sp|O89091|KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus GN=Klf10 PE=1 SV=1 59 110 2.0E-06
sp|Q3V080|ZN583_MOUSE Zinc finger protein 583 OS=Mus musculus GN=Znf583 PE=2 SV=1 59 117 2.0E-06
sp|Q12041|MET32_YEAST Transcriptional regulator MET32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET32 PE=1 SV=1 63 111 2.0E-06
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 59 108 2.0E-06
sp|Q99LH4|ZN672_MOUSE Zinc finger protein 672 OS=Mus musculus GN=Znf672 PE=2 SV=1 59 107 2.0E-06
sp|A8MUZ8|Z705G_HUMAN Putative zinc finger protein 705G OS=Homo sapiens GN=ZNF705G PE=2 SV=2 59 109 2.0E-06
sp|O08876|KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus GN=Klf10 PE=2 SV=1 66 110 2.0E-06
sp|Q96NJ6|ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens GN=ZFP3 PE=2 SV=1 59 108 2.0E-06
sp|Q91ZD1|OSR2_MOUSE Protein odd-skipped-related 2 OS=Mus musculus GN=Osr2 PE=1 SV=1 59 121 2.0E-06
sp|Q5JT82|KLF17_HUMAN Krueppel-like factor 17 OS=Homo sapiens GN=KLF17 PE=1 SV=1 59 109 2.0E-06
sp|Q96PE6|ZIM3_HUMAN Zinc finger imprinted 3 OS=Homo sapiens GN=ZIM3 PE=2 SV=1 59 112 2.0E-06
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 56 110 3.0E-06
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 56 110 3.0E-06
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 56 110 3.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 59 108 3.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 59 108 3.0E-06
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 59 167 3.0E-06
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 59 117 3.0E-06
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 58 107 3.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 59 131 3.0E-06
sp|P18727|ZG52_XENLA Gastrula zinc finger protein XlCGF52.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 112 3.0E-06
sp|P18733|ZG66_XENLA Gastrula zinc finger protein XlCGF66.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 59 112 3.0E-06
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 59 109 3.0E-06
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 59 109 3.0E-06
sp|Q5T619|ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens GN=ZNF648 PE=2 SV=1 59 117 3.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 59 117 3.0E-06
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 57 109 3.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 59 117 3.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 59 117 3.0E-06
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 59 117 3.0E-06
sp|Q8N2R0|OSR2_HUMAN Protein odd-skipped-related 2 OS=Homo sapiens GN=OSR2 PE=1 SV=2 59 121 3.0E-06
sp|Q9UL58|ZN215_HUMAN Zinc finger protein 215 OS=Homo sapiens GN=ZNF215 PE=2 SV=2 63 112 3.0E-06
sp|Q8K2R5|ZN668_MOUSE Zinc finger protein 668 OS=Mus musculus GN=Znf668 PE=2 SV=1 59 121 3.0E-06
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 59 167 3.0E-06
sp|Q8N8Y5|ZFP41_HUMAN Zinc finger protein 41 homolog OS=Homo sapiens GN=ZFP41 PE=2 SV=1 59 110 3.0E-06
sp|Q8N8Y5|ZFP41_HUMAN Zinc finger protein 41 homolog OS=Homo sapiens GN=ZFP41 PE=2 SV=1 59 117 3.0E-06
sp|P26634|EGR2_CERTH E3 SUMO-protein ligase EGR2 (Fragment) OS=Cerdocyon thous GN=EGR2 PE=3 SV=1 59 96 3.0E-06
sp|Q567J8|OSR2_DANRE Protein odd-skipped-related 2 OS=Danio rerio GN=osr2 PE=2 SV=1 59 116 3.0E-06
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 48 121 3.0E-06
sp|Q08DS3|OSR1_BOVIN Protein odd-skipped-related 1 OS=Bos taurus GN=OSR1 PE=2 SV=2 59 108 3.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 59 117 3.0E-06
sp|Q7L945|ZN627_HUMAN Zinc finger protein 627 OS=Homo sapiens GN=ZNF627 PE=1 SV=1 59 121 3.0E-06
sp|Q8TAX0|OSR1_HUMAN Protein odd-skipped-related 1 OS=Homo sapiens GN=OSR1 PE=2 SV=1 59 108 3.0E-06
sp|B0K011|OSR1_RAT Protein odd-skipped-related 1 OS=Rattus norvegicus GN=Osr1 PE=2 SV=1 59 108 3.0E-06
sp|Q9WVG7|OSR1_MOUSE Protein odd-skipped-related 1 OS=Mus musculus GN=Osr1 PE=2 SV=1 59 108 3.0E-06
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 59 117 3.0E-06
sp|P18748|ZO29_XENLA Oocyte zinc finger protein XlCOF29 OS=Xenopus laevis PE=2 SV=1 59 119 3.0E-06
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 59 117 3.0E-06
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 59 121 3.0E-06
sp|Q13118|KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens GN=KLF10 PE=1 SV=1 66 110 3.0E-06
sp|Q2TA17|ZN668_BOVIN Zinc finger protein 668 OS=Bos taurus GN=ZNF668 PE=2 SV=2 59 121 3.0E-06
sp|Q7TNK3|ZNF24_RAT Zinc finger protein 24 OS=Rattus norvegicus GN=Znf24 PE=2 SV=1 59 117 3.0E-06
sp|Q5RAE6|ZNF24_PONAB Zinc finger protein 24 OS=Pongo abelii GN=ZNF24 PE=2 SV=1 59 117 3.0E-06
sp|A1YGJ4|ZNF24_PANPA Zinc finger protein 24 OS=Pan paniscus GN=ZNF24 PE=3 SV=1 59 117 3.0E-06
sp|Q66K89|E4F1_HUMAN Transcription factor E4F1 OS=Homo sapiens GN=E4F1 PE=1 SV=2 59 107 3.0E-06
sp|B7ZRU9|EVI1A_XENLA MDS1 and EVI1 complex locus protein EVI1-A OS=Xenopus laevis GN=mecom-a PE=1 SV=1 59 163 3.0E-06
sp|G3X9G7|ZN809_MOUSE Zinc finger protein 809 OS=Mus musculus GN=Zfp809 PE=2 SV=1 30 109 3.0E-06
sp|P08151|GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens GN=GLI1 PE=1 SV=1 59 117 3.0E-06
sp|A2T7D7|ZNF24_PANTR Zinc finger protein 24 OS=Pan troglodytes GN=ZNF24 PE=3 SV=1 59 117 3.0E-06
sp|P17028|ZNF24_HUMAN Zinc finger protein 24 OS=Homo sapiens GN=ZNF24 PE=1 SV=4 59 117 3.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 59 179 3.0E-06
sp|Q91VN1|ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus GN=Znf24 PE=1 SV=1 59 117 3.0E-06
sp|O35819|KLF6_RAT Krueppel-like factor 6 OS=Rattus norvegicus GN=Klf6 PE=2 SV=2 59 110 3.0E-06
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 57 117 4.0E-06
sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 59 109 4.0E-06
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 59 109 4.0E-06
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 59 166 4.0E-06
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 59 117 4.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 59 107 4.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 59 109 4.0E-06
sp|Q32KN0|ZN572_BOVIN Zinc finger protein 572 OS=Bos taurus GN=ZNF572 PE=2 SV=1 59 117 4.0E-06
sp|Q86T29|ZN605_HUMAN Zinc finger protein 605 OS=Homo sapiens GN=ZNF605 PE=2 SV=1 59 108 4.0E-06
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 59 108 4.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 59 167 4.0E-06
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 59 117 4.0E-06
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 59 117 4.0E-06
sp|Q5RBQ3|ZN549_PONAB Zinc finger protein 549 OS=Pongo abelii GN=ZNF549 PE=2 SV=1 59 117 4.0E-06
sp|Q6P9A3|ZN549_HUMAN Zinc finger protein 549 OS=Homo sapiens GN=ZNF549 PE=2 SV=2 59 117 4.0E-06
sp|P39959|YEW0_YEAST Zinc finger protein YER130C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YER130C PE=3 SV=2 63 107 4.0E-06
sp|Q8CCE9|E4F1_MOUSE Transcription factor E4F1 OS=Mus musculus GN=E4f1 PE=1 SV=2 59 107 4.0E-06
sp|Q86UQ0|ZN589_HUMAN Zinc finger protein 589 OS=Homo sapiens GN=ZNF589 PE=1 SV=1 59 117 4.0E-06
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 54 117 4.0E-06
sp|Q6AY34|OSR2_RAT Protein odd-skipped-related 2 OS=Rattus norvegicus GN=Osr2 PE=2 SV=1 59 108 4.0E-06
sp|Q3T135|OSR2_BOVIN Protein odd-skipped-related 2 OS=Bos taurus GN=OSR2 PE=2 SV=1 59 108 4.0E-06
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 59 148 4.0E-06
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 36 125 4.0E-06
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 59 107 4.0E-06
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 59 112 4.0E-06
sp|O08584|KLF6_MOUSE Krueppel-like factor 6 OS=Mus musculus GN=Klf6 PE=2 SV=3 59 110 4.0E-06
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 59 108 4.0E-06
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 59 117 4.0E-06
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 26 108 4.0E-06
sp|P17027|ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens GN=ZNF23 PE=2 SV=3 59 117 4.0E-06
sp|Q9UDV6|ZN212_HUMAN Zinc finger protein 212 OS=Homo sapiens GN=ZNF212 PE=1 SV=3 62 113 4.0E-06
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 59 150 4.0E-06
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 59 109 4.0E-06
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 61 109 4.0E-06
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 59 109 4.0E-06
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 63 108 4.0E-06
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 59 117 4.0E-06
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 59 109 4.0E-06
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 59 109 4.0E-06
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 31 109 4.0E-06
sp|A6QNZ0|ZSC26_BOVIN Zinc finger and SCAN domain-containing protein 26 OS=Bos taurus GN=ZSCAN26 PE=2 SV=1 59 115 4.0E-06
sp|P18728|ZG53_XENLA Gastrula zinc finger protein XlCGF53.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 56 117 4.0E-06
sp|Q60980|KLF3_MOUSE Krueppel-like factor 3 OS=Mus musculus GN=Klf3 PE=1 SV=1 59 110 4.0E-06
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 59 121 4.0E-06
sp|A2T7F4|ZSC12_PONPY Zinc finger and SCAN domain-containing protein 12 OS=Pongo pygmaeus GN=ZSCAN12 PE=3 SV=1 21 108 4.0E-06
sp|Q5R4X5|ZNF22_PONAB Zinc finger protein 22 OS=Pongo abelii GN=ZNF22 PE=2 SV=1 59 117 5.0E-06
sp|P17026|ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens GN=ZNF22 PE=1 SV=3 59 117 5.0E-06
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 59 107 5.0E-06
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 59 107 5.0E-06
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 59 107 5.0E-06
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 59 107 5.0E-06
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 59 107 5.0E-06
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 59 107 5.0E-06
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 59 117 5.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 48 121 5.0E-06
sp|P18726|ZG5A_XENLA Gastrula zinc finger protein XlCGF51.1A (Fragment) OS=Xenopus laevis PE=3 SV=1 59 116 5.0E-06
sp|Q8R0T2|ZN768_MOUSE Zinc finger protein 768 OS=Mus musculus GN=Znf768 PE=1 SV=1 59 119 5.0E-06
sp|P18741|ZO15_XENLA Oocyte zinc finger protein XlCOF15 (Fragment) OS=Xenopus laevis PE=3 SV=1 59 107 5.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 48 121 5.0E-06
sp|Q14929|ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens GN=ZNF169 PE=1 SV=3 59 109 5.0E-06
sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 51 110 5.0E-06
sp|Q96K58|ZN668_HUMAN Zinc finger protein 668 OS=Homo sapiens GN=ZNF668 PE=1 SV=3 59 121 5.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 59 109 5.0E-06
sp|Q9VQS7|SOB_DROME Protein sister of odd and bowel OS=Drosophila melanogaster GN=sob PE=2 SV=1 59 125 5.0E-06
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 59 117 5.0E-06
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 59 115 5.0E-06
sp|P51508|ZNF81_HUMAN Zinc finger protein 81 OS=Homo sapiens GN=ZNF81 PE=1 SV=3 48 117 5.0E-06
sp|Q29RZ4|ZNF2_BOVIN Zinc finger protein 2 OS=Bos taurus GN=ZNF2 PE=2 SV=1 52 107 5.0E-06
sp|P17041|ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens GN=ZNF32 PE=1 SV=2 59 107 5.0E-06
sp|Q6ZNG0|ZN620_HUMAN Zinc finger protein 620 OS=Homo sapiens GN=ZNF620 PE=2 SV=1 37 108 5.0E-06
sp|E9QAG8|ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus GN=Znf431 PE=1 SV=1 59 117 5.0E-06
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 59 117 5.0E-06
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 59 117 5.0E-06
sp|Q6P1L6|ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens GN=ZNF343 PE=1 SV=1 59 108 5.0E-06
sp|Q5RJ54|ZSC26_MOUSE Zinc finger and SCAN domain-containing protein 26 OS=Mus musculus GN=Zscan26 PE=2 SV=1 59 112 5.0E-06
sp|Q5CZA5|ZN805_HUMAN Zinc finger protein 805 OS=Homo sapiens GN=ZNF805 PE=2 SV=3 59 107 5.0E-06
sp|Q96GE5|ZN799_HUMAN Zinc finger protein 799 OS=Homo sapiens GN=ZNF799 PE=2 SV=4 59 117 5.0E-06
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 59 121 5.0E-06
sp|P15621|ZNF44_HUMAN Zinc finger protein 44 OS=Homo sapiens GN=ZNF44 PE=2 SV=3 59 109 5.0E-06
sp|P10069|BRLA_EMENI Regulatory protein brlA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=brlA PE=3 SV=1 66 112 5.0E-06
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 59 117 5.0E-06
sp|Q9BS31|ZN649_HUMAN Zinc finger protein 649 OS=Homo sapiens GN=ZNF649 PE=1 SV=1 59 167 5.0E-06
sp|P18723|ZG48_XENLA Gastrula zinc finger protein XlCGF48.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 59 109 5.0E-06
sp|P21506|ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens GN=ZNF10 PE=1 SV=3 57 109 5.0E-06
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 59 117 5.0E-06
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 59 108 6.0E-06
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 59 107 6.0E-06
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 59 109 6.0E-06
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 59 107 6.0E-06
sp|Q86UD4|ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens GN=ZNF329 PE=1 SV=2 59 121 6.0E-06
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 59 107 6.0E-06
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 59 107 6.0E-06
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 58 107 6.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 59 108 6.0E-06
sp|Q9BSK1|ZN577_HUMAN Zinc finger protein 577 OS=Homo sapiens GN=ZNF577 PE=2 SV=3 59 109 6.0E-06
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 60 109 6.0E-06
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 59 117 6.0E-06
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 8 107 6.0E-06
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 59 109 6.0E-06
sp|Q966L8|CHE1_CAEEL Transcription factor che-1 OS=Caenorhabditis elegans GN=che-1 PE=1 SV=3 58 109 6.0E-06
sp|Q02525|ZFP39_MOUSE Zinc finger protein 39 OS=Mus musculus GN=Zfp39 PE=2 SV=2 36 108 6.0E-06
sp|Q6NX45|ZN774_HUMAN Zinc finger protein 774 OS=Homo sapiens GN=ZNF774 PE=1 SV=2 59 109 6.0E-06
sp|Q80V23|ZNF32_MOUSE Zinc finger protein 32 OS=Mus musculus GN=Znf32 PE=2 SV=1 59 107 6.0E-06
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 59 117 6.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 41 167 6.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 59 117 6.0E-06
sp|Q7Z340|ZN551_HUMAN Zinc finger protein 551 OS=Homo sapiens GN=ZNF551 PE=2 SV=3 59 167 6.0E-06
sp|P57682|KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens GN=KLF3 PE=1 SV=1 59 110 6.0E-06
sp|Q96HQ0|ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens GN=ZNF419 PE=1 SV=2 59 117 6.0E-06
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 59 134 6.0E-06
sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=1 SV=1 59 109 6.0E-06
sp|O43361|ZN749_HUMAN Zinc finger protein 749 OS=Homo sapiens GN=ZNF749 PE=1 SV=2 57 112 6.0E-06
sp|Q29W20|EGR1_BOVIN Early growth response protein 1 OS=Bos taurus GN=EGR1 PE=2 SV=1 63 112 6.0E-06
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 59 117 7.0E-06
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 59 117 7.0E-06
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 59 107 7.0E-06
sp|P52740|ZN132_HUMAN Zinc finger protein 132 OS=Homo sapiens GN=ZNF132 PE=2 SV=2 59 117 7.0E-06
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 59 110 7.0E-06
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 59 107 7.0E-06
sp|Q9H116|GZF1_HUMAN GDNF-inducible zinc finger protein 1 OS=Homo sapiens GN=GZF1 PE=1 SV=1 59 117 7.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 59 108 7.0E-06
sp|P30373|CKR1_CHICK Zinc finger protein CKR1 OS=Gallus gallus PE=2 SV=1 35 109 7.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 59 109 7.0E-06
sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 59 117 7.0E-06
sp|Q8BLB0|ZFP3_MOUSE Zinc finger protein 3 OS=Mus musculus GN=Zfp3 PE=2 SV=1 18 117 7.0E-06
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 59 108 7.0E-06
sp|Q6DDV0|MYNN_XENLA Myoneurin OS=Xenopus laevis GN=mynn PE=2 SV=1 59 117 7.0E-06
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 59 107 7.0E-06
sp|Q9H5J0|ZBTB3_HUMAN Zinc finger and BTB domain-containing protein 3 OS=Homo sapiens GN=ZBTB3 PE=1 SV=1 62 151 7.0E-06
sp|Q9Y2A4|ZN443_HUMAN Zinc finger protein 443 OS=Homo sapiens GN=ZNF443 PE=2 SV=2 59 109 7.0E-06
sp|P58334|KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus GN=Klf16 PE=1 SV=2 59 136 7.0E-06
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 59 107 7.0E-06
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 30 117 7.0E-06
sp|Q13398|ZN211_HUMAN Zinc finger protein 211 OS=Homo sapiens GN=ZNF211 PE=2 SV=2 59 107 7.0E-06
sp|Q5A0E5|NRG1_CANAL Transcriptional regulator NRG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NRG1 PE=2 SV=1 56 126 7.0E-06
sp|Q3KQV3|ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens GN=ZNF792 PE=1 SV=2 60 109 7.0E-06
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 59 109 7.0E-06
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 59 117 7.0E-06
sp|P56670|MAZ_MESAU Myc-associated zinc finger protein (Fragment) OS=Mesocricetus auratus GN=MAZ PE=2 SV=1 61 107 7.0E-06
sp|Q2TL60|ZN667_MOUSE Zinc finger protein 667 OS=Mus musculus GN=Znf667 PE=2 SV=1 59 117 7.0E-06
sp|Q62255|SALL3_MOUSE Sal-like protein 3 OS=Mus musculus GN=Sall3 PE=1 SV=2 46 122 7.0E-06
sp|Q99JB0|KLF7_MOUSE Krueppel-like factor 7 OS=Mus musculus GN=Klf7 PE=2 SV=1 59 110 7.0E-06
sp|Q5RE50|ZN215_PONAB Zinc finger protein 215 OS=Pongo abelii GN=ZNF215 PE=2 SV=1 63 112 7.0E-06
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 59 107 8.0E-06
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 59 107 8.0E-06
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 59 117 8.0E-06
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 59 107 8.0E-06
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 59 117 8.0E-06
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 61 121 8.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 59 109 8.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 59 121 8.0E-06
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 59 107 8.0E-06
sp|P18723|ZG48_XENLA Gastrula zinc finger protein XlCGF48.2 (Fragment) OS=Xenopus laevis PE=2 SV=1 59 109 8.0E-06
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 59 109 8.0E-06
sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 59 215 8.0E-06
sp|Q499Z4|ZN672_HUMAN Zinc finger protein 672 OS=Homo sapiens GN=ZNF672 PE=2 SV=2 59 109 8.0E-06
sp|Q96JF6|ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens GN=ZNF594 PE=2 SV=3 59 117 8.0E-06
sp|Q96JF6|ZN594_HUMAN Zinc finger protein 594 OS=Homo sapiens GN=ZNF594 PE=2 SV=3 59 117 8.0E-06
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 59 117 8.0E-06
sp|Q9H4T2|ZSC16_HUMAN Zinc finger and SCAN domain-containing protein 16 OS=Homo sapiens GN=ZSCAN16 PE=1 SV=2 59 109 8.0E-06
sp|O75840|KLF7_HUMAN Krueppel-like factor 7 OS=Homo sapiens GN=KLF7 PE=2 SV=1 59 110 8.0E-06
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 56 113 8.0E-06
sp|A2T7G6|ZSCA4_PONPY Zinc finger and SCAN domain-containing protein 4 OS=Pongo pygmaeus GN=ZSCAN4 PE=3 SV=1 59 121 8.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 59 109 8.0E-06
sp|Q6ZN19|ZN841_HUMAN Zinc finger protein 841 OS=Homo sapiens GN=ZNF841 PE=2 SV=1 59 117 8.0E-06
sp|Q2EI21|RESTA_XENLA RE1-silencing transcription factor A OS=Xenopus laevis GN=rest-a PE=2 SV=1 59 121 8.0E-06
sp|Q15697|ZN174_HUMAN Zinc finger protein 174 OS=Homo sapiens GN=ZNF174 PE=1 SV=1 59 117 8.0E-06
sp|Q9BXA9|SALL3_HUMAN Sal-like protein 3 OS=Homo sapiens GN=SALL3 PE=1 SV=2 46 122 8.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 59 108 8.0E-06
sp|Q9VQU9|BOWEL_DROME Protein bowel OS=Drosophila melanogaster GN=bowl PE=1 SV=1 59 121 8.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 59 109 9.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 59 108 9.0E-06
sp|P18742|ZO19_XENLA Oocyte zinc finger protein XlCOF19 (Fragment) OS=Xenopus laevis PE=3 SV=1 54 119 9.0E-06
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 59 109 9.0E-06
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 59 109 9.0E-06
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 59 117 9.0E-06
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 59 109 9.0E-06
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 63 117 9.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 59 167 9.0E-06
sp|Q9HAZ2|PRD16_HUMAN PR domain zinc finger protein 16 OS=Homo sapiens GN=PRDM16 PE=1 SV=3 35 117 9.0E-06
sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 60 167 9.0E-06
sp|A2A935|PRD16_MOUSE PR domain zinc finger protein 16 OS=Mus musculus GN=Prdm16 PE=1 SV=1 35 117 9.0E-06
sp|G3X9G7|ZN809_MOUSE Zinc finger protein 809 OS=Mus musculus GN=Zfp809 PE=2 SV=1 59 110 9.0E-06
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 36 167 9.0E-06
sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 59 132 9.0E-06
sp|Q99612|KLF6_HUMAN Krueppel-like factor 6 OS=Homo sapiens GN=KLF6 PE=1 SV=3 59 110 9.0E-06
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 59 109 9.0E-06
sp|Q8R2V3|ZN445_MOUSE Zinc finger protein 445 OS=Mus musculus GN=Znf445 PE=2 SV=2 35 107 9.0E-06
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 59 109 9.0E-06
sp|Q8TAU3|ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens GN=ZNF417 PE=1 SV=2 59 128 9.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 59 109 9.0E-06
sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=1 SV=1 59 117 9.0E-06
sp|Q5FWF6|ZN789_HUMAN Zinc finger protein 789 OS=Homo sapiens GN=ZNF789 PE=2 SV=3 59 108 9.0E-06
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 59 109 9.0E-06
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 59 109 1.0E-05
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 59 117 1.0E-05
sp|P18733|ZG66_XENLA Gastrula zinc finger protein XlCGF66.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 59 112 1.0E-05
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 59 121 1.0E-05
sp|Q3URR7|ZSC10_MOUSE Zinc finger and SCAN domain-containing protein 10 OS=Mus musculus GN=Zscan10 PE=1 SV=2 59 107 1.0E-05
sp|Q96NI8|ZN570_HUMAN Zinc finger protein 570 OS=Homo sapiens GN=ZNF570 PE=2 SV=1 59 117 1.0E-05
sp|Q5REN4|ZN248_PONAB Zinc finger protein 248 OS=Pongo abelii GN=ZNF248 PE=2 SV=1 59 109 1.0E-05
sp|Q5XJQ7|OSR1_DANRE Protein odd-skipped-related 1 OS=Danio rerio GN=osr1 PE=2 SV=1 59 108 1.0E-05
sp|Q96BR6|ZN669_HUMAN Zinc finger protein 669 OS=Homo sapiens GN=ZNF669 PE=2 SV=2 59 109 1.0E-05
sp|Q60821|ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus GN=Zbtb17 PE=1 SV=2 56 113 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0003677 DNA binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0003676 nucleic acid binding No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0019438 aromatic compound biosynthetic process No
GO:0016070 RNA metabolic process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0046914 transition metal ion binding No
GO:0097159 organic cyclic compound binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0009059 macromolecule biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0032774 RNA biosynthetic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF
C2H2 zinc finger

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4832
MGSNDAEPRLSRASIMPNPSPSGSTVAASQPIPDDNASSITVNTKAPSNFPPPKTDKPRPHVCATCQRSFARLEH
LKRHERSHTKEKPFECPECSRCFARRDLLLRHQQKLHQTSTPSSRPRNRRESASGIVPGQSRARKNSVAGANPTG
DNAAPASMRPRANTISHVDGAAMQMIASGNASAARGIIAHSRHPSLGGLPTHGLDHVLGGMSAALGHRGMQHGLP
KLETSQMGGGEFESGLRTAPPMAVFSEFEFEGLLFGHSSTINPNALHYNDSPQAMTVDQTPFGQSMTDVTSSQPY
DDGLDWFTGFEHQMSFQTSENVVDGSSPSAISTTSQSGMSDVMLDGSNHPAPAGTSTMWHSSIMGPPQMSNPFAM
DLNGSVFPDLLNGAPLSPQPAPQKMNDPYFSTPPPSLSSMSPSVVSGMNTQNLSQTMGFNAGPETPSSPGGGGGN
NGASPVTTISDATRIALVNALAQYPPSGGRKCSAASQDSPLSPQFQPGANAASLQTSAKLPSTQDLQRYVGAYLA
YFHPHLPFLHVPTLSFDPSPTLSGRLTGVGDGGCLLLSMAAIGALYEMEHARSAELLRMAEDVISHHIQKLRRTD
AQGGETRHNTLDTGRVSPADDGAARTPVRLVQAVLLYVVGACGHEETDDKAGGTGSTHCSALVGLAQAARLLQTL
SPMRRDVQMADDTNSCRLKDQEEHRDWLAWKSVEERKRTLHAVFIVSSLLVAAYNKVPALTNSELSLDLPCDEEF
FAAESSAAFTTRGGAEAADRNRVTFYDALGALLRTDEKQQKKEATDDSNETPSDAKPSSFGCLILINSLHNYIWE
TRQRHRGVWTAEETDKMHRHIEPALKAWQMAWASNPQHSVERPNPFGTGPLSADAVPLLDLAYVRLFVDLSRSKE
KFWQRDWVGVTEELTRAGGVAECSQATSAKSHAIDGSERSAQDDIGCEASDQSAASRERNLRKAAFYAADSLAMS
DRLGVTFVDYTRGELPLQSALCTLDCAQVLAEWISTLQDRVGRYLGVLAQNPADLGQLPAMVLLEEEDVKLLGKV
REILTSAEMKLGIGLGGDSMSLSGDVGGSAVRGHDRLGLAAKLLRMTARMLGQAAVWPCVRSMSRCLEVHALDAQ
ARAERSVAPLE
Coding >Ophio5|4832
ATGGGTTCCAACGACGCTGAGCCCAGGCTGTCGCGAGCTTCGATAATGCCGAATCCCTCGCCCTCGGGCTCGACC
GTCGCTGCTAGCCAGCCCATTCCAGACGACAACGCATCATCCATTACGGTCAATACCAAAGCACCCTCCAACTTT
CCCCCCCCCAAGACTGATAAGCCTCGACCGCACGTCTGCGCCACTTGCCAGCGATCCTTTGCCCGGCTGGAGCAC
CTGAAACGCCACGAGCGCTCTCACACCAAGGAAAAGCCCTTCGAGTGCCCCGAATGTTCGAGATGTTTTGCTCGC
CGCGACCTGCTTCTGCGGCACCAGCAGAAGCTACACCAGACGTCGACCCCGTCGTCACGCCCGCGCAATCGCCGC
GAGTCCGCTAGCGGCATCGTCCCGGGCCAAAGTAGAGCCCGCAAGAACAGCGTGGCCGGCGCCAACCCCACCGGT
GATAACGCCGCGCCCGCCTCTATGCGGCCGAGGGCAAACACCATCAGTCACGTCGACGGCGCCGCCATGCAGATG
ATTGCGTCGGGCAATGCGTCCGCCGCGCGAGGCATCATCGCTCACAGCCGTCACCCGAGTCTAGGTGGCCTGCCC
ACCCACGGCCTGGACCACGTCCTCGGCGGCATGTCGGCCGCCCTGGGCCACAGGGGGATGCAGCACGGCCTGCCC
AAGCTGGAGACGTCGCAGATGGGCGGCGGCGAGTTCGAAAGCGGCCTGCGGACGGCGCCGCCGATGGCCGTCTTC
TCCGAGTTCGAATTCGAGGGACTTTTGTTCGGCCATAGCTCCACCATCAACCCCAATGCCCTCCACTACAACGAC
TCTCCGCAGGCCATGACCGTCGATCAGACGCCGTTTGGCCAGAGCATGACTGACGTGACGTCGAGTCAGCCCTAT
GACGACGGCCTGGACTGGTTCACCGGCTTCGAGCACCAGATGTCCTTCCAGACCAGCGAGAACGTGGTTGATGGG
TCGAGCCCTTCGGCCATCAGCACCACGAGCCAGAGCGGCATGAGCGACGTAATGCTAGACGGATCCAATCACCCA
GCGCCGGCCGGCACGAGCACCATGTGGCACTCGTCGATCATGGGCCCTCCCCAGATGTCCAACCCCTTTGCGATG
GATCTCAATGGGTCGGTCTTTCCTGATCTCCTCAATGGAGCCCCTTTATCACCTCAGCCAGCACCTCAAAAGATG
AATGACCCGTACTTCTCTACGCCTCCGCCATCGCTGAGCTCCATGAGCCCGTCAGTCGTGTCGGGCATGAATACG
CAGAACCTGAGCCAGACCATGGGCTTCAACGCCGGCCCCGAAACTCCGTCATCTCCCGGCGGCGGCGGCGGCAAC
AACGGCGCCTCTCCCGTGACAACAATCTCCGATGCCACGCGGATTGCCCTCGTGAACGCGCTCGCCCAGTACCCG
CCCTCTGGTGGCCGTAAATGCTCCGCCGCATCTCAGGACTCGCCGCTCTCGCCCCAGTTCCAGCCTGGTGCGAAC
GCAGCCTCCCTCCAGACGTCAGCCAAGCTGCCCAGTACCCAGGACCTGCAGCGCTACGTTGGGGCCTACCTGGCC
TACTTCCACCCTCACCTCCCATTCTTGCACGTTCCCACCTTGTCATTTGACCCGTCTCCCACTCTGTCTGGTCGC
TTAACCGGTGTAGGCGATGGTGGGTGTCTGCTCCTATCCATGGCCGCGATCGGCGCCCTCTACGAGATGGAACAC
GCGCGGTCGGCCGAGCTGCTTCGGATGGCCGAAGACGTCATCTCTCACCACATCCAGAAGCTGAGGAGGACGGAC
GCCCAAGGAGGCGAGACGCGGCACAACACGCTCGACACGGGCCGCGTCTCCCCTGCCGACGATGGCGCGGCCAGG
ACCCCTGTCCGACTCGTCCAGGCGGTGCTTCTCTACGTCGTCGGCGCCTGCGGCCACGAGGAAACCGACGACAAG
GCTGGCGGCACGGGCTCGACGCACTGCTCCGCGCTCGTGGGTCTCGCCCAGGCGGCCCGTCTCCTGCAGACCCTC
TCCCCGATGAGGCGTGACGTCCAGATGGCCGACGACACGAACTCGTGCCGTCTCAAGGATCAGGAGGAGCACCGC
GATTGGCTGGCATGGAAGAGCGTGGAGGAGCGGAAACGGACGCTTCACGCCGTCTTCATCGTTTCCAGTCTCCTC
GTAGCGGCCTACAACAAGGTGCCGGCACTGACCAACTCGGAATTGTCGCTGGATCTTCCCTGCGACGAGGAGTTC
TTCGCTGCAGAGTCCAGCGCTGCCTTCACGACACGTGGCGGCGCCGAGGCTGCGGATCGCAACCGTGTGACTTTC
TACGATGCCTTGGGGGCGCTGCTTCGGACAGACGAGAAGCAGCAGAAGAAGGAGGCCACCGATGACAGCAATGAG
ACGCCGAGCGACGCGAAGCCGAGCTCATTCGGCTGCCTGATATTGATCAACTCCCTCCACAACTACATCTGGGAA
ACGCGCCAGCGGCACCGCGGCGTGTGGACGGCGGAAGAGACGGACAAGATGCACCGACACATCGAGCCCGCCCTC
AAGGCGTGGCAGATGGCATGGGCCAGCAACCCGCAACACAGCGTCGAGCGACCAAACCCCTTTGGCACGGGGCCT
CTCTCCGCCGACGCCGTACCGCTCCTCGACCTCGCCTACGTGCGGCTGTTCGTCGACCTCTCACGATCCAAGGAG
AAGTTCTGGCAGCGAGACTGGGTCGGGGTGACGGAGGAGTTGACTCGCGCCGGCGGCGTCGCCGAGTGCTCGCAG
GCCACCTCTGCCAAGTCCCATGCGATCGACGGCTCAGAGAGGTCGGCACAGGACGACATCGGGTGCGAAGCGTCG
GACCAATCGGCCGCGAGCAGGGAACGGAACCTGAGGAAGGCGGCTTTCTACGCGGCCGACTCTCTGGCCATGTCT
GACCGGCTCGGCGTTACGTTCGTCGACTACACGCGCGGCGAGCTGCCGCTGCAGTCGGCCCTGTGTACCTTGGAC
TGCGCCCAGGTGTTGGCCGAATGGATATCGACGCTACAGGACCGGGTTGGCCGCTACCTGGGAGTGCTCGCGCAG
AACCCGGCTGATCTTGGGCAGCTACCTGCCATGGTGCTCCTGGAGGAGGAAGATGTCAAGCTCTTGGGCAAGGTG
CGCGAAATATTGACATCGGCAGAGATGAAGCTTGGCATTGGTCTGGGGGGAGATTCAATGAGCCTGAGTGGTGAC
GTCGGGGGCTCGGCCGTTCGGGGCCATGACCGCCTCGGTCTGGCGGCCAAGCTTCTGCGGATGACGGCGCGGATG
CTGGGCCAGGCTGCCGTGTGGCCCTGTGTACGCTCGATGAGCCGCTGTCTCGAGGTCCATGCCCTTGACGCCCAG
GCGAGGGCCGAGCGTTCCGTCGCGCCGCTCGAG
Transcript >Ophio5|4832
ATGGGTTCCAACGACGCTGAGCCCAGGCTGTCGCGAGCTTCGATAATGCCGAATCCCTCGCCCTCGGGCTCGACC
GTCGCTGCTAGCCAGCCCATTCCAGACGACAACGCATCATCCATTACGGTCAATACCAAAGCACCCTCCAACTTT
CCCCCCCCCAAGACTGATAAGCCTCGACCGCACGTCTGCGCCACTTGCCAGCGATCCTTTGCCCGGCTGGAGCAC
CTGAAACGCCACGAGCGCTCTCACACCAAGGAAAAGCCCTTCGAGTGCCCCGAATGTTCGAGATGTTTTGCTCGC
CGCGACCTGCTTCTGCGGCACCAGCAGAAGCTACACCAGACGTCGACCCCGTCGTCACGCCCGCGCAATCGCCGC
GAGTCCGCTAGCGGCATCGTCCCGGGCCAAAGTAGAGCCCGCAAGAACAGCGTGGCCGGCGCCAACCCCACCGGT
GATAACGCCGCGCCCGCCTCTATGCGGCCGAGGGCAAACACCATCAGTCACGTCGACGGCGCCGCCATGCAGATG
ATTGCGTCGGGCAATGCGTCCGCCGCGCGAGGCATCATCGCTCACAGCCGTCACCCGAGTCTAGGTGGCCTGCCC
ACCCACGGCCTGGACCACGTCCTCGGCGGCATGTCGGCCGCCCTGGGCCACAGGGGGATGCAGCACGGCCTGCCC
AAGCTGGAGACGTCGCAGATGGGCGGCGGCGAGTTCGAAAGCGGCCTGCGGACGGCGCCGCCGATGGCCGTCTTC
TCCGAGTTCGAATTCGAGGGACTTTTGTTCGGCCATAGCTCCACCATCAACCCCAATGCCCTCCACTACAACGAC
TCTCCGCAGGCCATGACCGTCGATCAGACGCCGTTTGGCCAGAGCATGACTGACGTGACGTCGAGTCAGCCCTAT
GACGACGGCCTGGACTGGTTCACCGGCTTCGAGCACCAGATGTCCTTCCAGACCAGCGAGAACGTGGTTGATGGG
TCGAGCCCTTCGGCCATCAGCACCACGAGCCAGAGCGGCATGAGCGACGTAATGCTAGACGGATCCAATCACCCA
GCGCCGGCCGGCACGAGCACCATGTGGCACTCGTCGATCATGGGCCCTCCCCAGATGTCCAACCCCTTTGCGATG
GATCTCAATGGGTCGGTCTTTCCTGATCTCCTCAATGGAGCCCCTTTATCACCTCAGCCAGCACCTCAAAAGATG
AATGACCCGTACTTCTCTACGCCTCCGCCATCGCTGAGCTCCATGAGCCCGTCAGTCGTGTCGGGCATGAATACG
CAGAACCTGAGCCAGACCATGGGCTTCAACGCCGGCCCCGAAACTCCGTCATCTCCCGGCGGCGGCGGCGGCAAC
AACGGCGCCTCTCCCGTGACAACAATCTCCGATGCCACGCGGATTGCCCTCGTGAACGCGCTCGCCCAGTACCCG
CCCTCTGGTGGCCGTAAATGCTCCGCCGCATCTCAGGACTCGCCGCTCTCGCCCCAGTTCCAGCCTGGTGCGAAC
GCAGCCTCCCTCCAGACGTCAGCCAAGCTGCCCAGTACCCAGGACCTGCAGCGCTACGTTGGGGCCTACCTGGCC
TACTTCCACCCTCACCTCCCATTCTTGCACGTTCCCACCTTGTCATTTGACCCGTCTCCCACTCTGTCTGGTCGC
TTAACCGGTGTAGGCGATGGTGGGTGTCTGCTCCTATCCATGGCCGCGATCGGCGCCCTCTACGAGATGGAACAC
GCGCGGTCGGCCGAGCTGCTTCGGATGGCCGAAGACGTCATCTCTCACCACATCCAGAAGCTGAGGAGGACGGAC
GCCCAAGGAGGCGAGACGCGGCACAACACGCTCGACACGGGCCGCGTCTCCCCTGCCGACGATGGCGCGGCCAGG
ACCCCTGTCCGACTCGTCCAGGCGGTGCTTCTCTACGTCGTCGGCGCCTGCGGCCACGAGGAAACCGACGACAAG
GCTGGCGGCACGGGCTCGACGCACTGCTCCGCGCTCGTGGGTCTCGCCCAGGCGGCCCGTCTCCTGCAGACCCTC
TCCCCGATGAGGCGTGACGTCCAGATGGCCGACGACACGAACTCGTGCCGTCTCAAGGATCAGGAGGAGCACCGC
GATTGGCTGGCATGGAAGAGCGTGGAGGAGCGGAAACGGACGCTTCACGCCGTCTTCATCGTTTCCAGTCTCCTC
GTAGCGGCCTACAACAAGGTGCCGGCACTGACCAACTCGGAATTGTCGCTGGATCTTCCCTGCGACGAGGAGTTC
TTCGCTGCAGAGTCCAGCGCTGCCTTCACGACACGTGGCGGCGCCGAGGCTGCGGATCGCAACCGTGTGACTTTC
TACGATGCCTTGGGGGCGCTGCTTCGGACAGACGAGAAGCAGCAGAAGAAGGAGGCCACCGATGACAGCAATGAG
ACGCCGAGCGACGCGAAGCCGAGCTCATTCGGCTGCCTGATATTGATCAACTCCCTCCACAACTACATCTGGGAA
ACGCGCCAGCGGCACCGCGGCGTGTGGACGGCGGAAGAGACGGACAAGATGCACCGACACATCGAGCCCGCCCTC
AAGGCGTGGCAGATGGCATGGGCCAGCAACCCGCAACACAGCGTCGAGCGACCAAACCCCTTTGGCACGGGGCCT
CTCTCCGCCGACGCCGTACCGCTCCTCGACCTCGCCTACGTGCGGCTGTTCGTCGACCTCTCACGATCCAAGGAG
AAGTTCTGGCAGCGAGACTGGGTCGGGGTGACGGAGGAGTTGACTCGCGCCGGCGGCGTCGCCGAGTGCTCGCAG
GCCACCTCTGCCAAGTCCCATGCGATCGACGGCTCAGAGAGGTCGGCACAGGACGACATCGGGTGCGAAGCGTCG
GACCAATCGGCCGCGAGCAGGGAACGGAACCTGAGGAAGGCGGCTTTCTACGCGGCCGACTCTCTGGCCATGTCT
GACCGGCTCGGCGTTACGTTCGTCGACTACACGCGCGGCGAGCTGCCGCTGCAGTCGGCCCTGTGTACCTTGGAC
TGCGCCCAGGTGTTGGCCGAATGGATATCGACGCTACAGGACCGGGTTGGCCGCTACCTGGGAGTGCTCGCGCAG
AACCCGGCTGATCTTGGGCAGCTACCTGCCATGGTGCTCCTGGAGGAGGAAGATGTCAAGCTCTTGGGCAAGGTG
CGCGAAATATTGACATCGGCAGAGATGAAGCTTGGCATTGGTCTGGGGGGAGATTCAATGAGCCTGAGTGGTGAC
GTCGGGGGCTCGGCCGTTCGGGGCCATGACCGCCTCGGTCTGGCGGCCAAGCTTCTGCGGATGACGGCGCGGATG
CTGGGCCAGGCTGCCGTGTGGCCCTGTGTACGCTCGATGAGCCGCTGTCTCGAGGTCCATGCCCTTGACGCCCAG
GCGAGGGCCGAGCGTTCCGTCGCGCCGCTCGAGTGA
Gene >Ophio5|4832
ATGGGTTCCAACGACGCTGAGCCCAGGCTGTCGCGAGCTTCGATAATGCCGAATCCCTCGCCCTCGGGCTCGACC
GTCGCTGCTAGCCAGCCCATTCCAGACGACAACGGTGAGCCTGCGACCCCAGGCGATGACCCTATCTTCTCAGTT
CTGTCCTTCAACTCCATCCTTCCCGACCTCAAGGAGCCTGCTGCTTCCCTCTCCTTGTGGCTTTCATGACTGTTC
AACTGGTTCGGCTCGATCCCCGTCTGTCAGGCTGTGCTTGCTAACTTGCCCCGACTCTTTTGATAGCATCATCCA
TTACGGTCAATACCAAAGCACCCTCCAACTTTCCCCCCCCCAAGACTGATAAGCCTCGACCGCACGTCTGCGCCA
CTTGCCAGCGATCCTTTGCCCGGCTGGAGCACCTGAAACGCCACGAGCGCTCTCACACCAAGGAAAAGCCCTTCG
AGTGCCCCGAATGTTCGAGATGTTTTGCTCGCCGCGACCTGCTTCTGCGGCACCAGCAGAAGCTACACCAGACGT
CGACCCCGTCGTCACGCCCGCGCAATCGCCGCGAGTCCGCTAGCGGCATCGTCCCGGGCCAAAGTAGAGCCCGCA
AGAACAGCGTGGCCGGCGCCAACCCCACCGGTGATAACGCCGCGCCCGCCTCTATGCGGCCGAGGGCAAACACCA
TCAGTCACGTCGACGGCGCCGCCATGCAGATGATTGCGTCGGGCAATGCGTCCGCCGCGCGAGGCATCATCGCTC
ACAGCCGTCACCCGAGTCTAGGTGGCCTGCCCACCCACGGCCTGGACCACGTCCTCGGCGGCATGTCGGCCGCCC
TGGGCCACAGGGGGATGCAGCACGGCCTGCCCAAGCTGGAGACGTCGCAGATGGGCGGCGGCGAGTTCGAAAGCG
GCCTGCGGACGGCGCCGCCGATGGCCGTCTTCTCCGAGTTCGAATTCGAGGGACTTTTGTTCGGCCATAGCTCCA
CCATCAACCCCAATGCCCTCCACTACAACGACTCTCCGCAGGCCATGACCGTCGATCAGACGCCGTTTGGCCAGA
GCATGACTGACGTGACGTCGAGTCAGCCCTATGACGACGGCCTGGACTGGTTCACCGGCTTCGAGCACCAGATGT
CCTTCCAGACCAGCGAGAACGTGGTTGATGGGTCGAGCCCTTCGGCCATCAGCACCACGAGCCAGAGCGGCATGA
GCGACGTAATGCTAGACGGATCCAATCACCCAGCGCCGGCCGGCACGAGCACCATGTGGCACTCGTCGATCATGG
GCCCTCCCCAGATGTCCAACCCCTTTGCGATGGATCTCAATGGGTCGGTCTTTCCTGATCTCCTCAATGGAGCCC
CTTTATCACCTCAGCCAGCACCTCAAAAGATGAATGACCCGTACTTCTCTACGCCTCCGCCATCGCTGAGCTCCA
TGAGCCCGTCAGTCGTGTCGGGCATGAATACGCAGAACCTGAGCCAGACCATGGGCTTCAACGCCGGCCCCGAAA
CTCCGTCATCTCCCGGCGGCGGCGGCGGCAACAACGGCGCCTCTCCCGTGACAACAATCTCCGATGCCACGCGGA
TTGCCCTCGTGAACGCGCTCGCCCAGTACCCGCCCTCTGGTGGCCGTAAATGCTCCGCCGCATCTCAGGACTCGC
CGCTCTCGCCCCAGTTCCAGCCTGGTGCGAACGCAGCCTCCCTCCAGACGTCAGCCAAGCTGCCCAGTACCCAGG
ACCTGCAGCGCTACGTTGGGGCCTACCTGGCCTACTTCCACCCTCACCTCCCATTCTTGCACGTTCCCACCTTGT
CATTTGACCCGTCTCCCACTCTGTCTGGTCGCTTAACCGGTGTAGGCGATGGTGGGTGTCTGCTCCTATCCATGG
CCGCGATCGGCGCCCTCTACGAGATGGAACACGCGCGGTCGGCCGAGCTGCTTCGGATGGCCGAAGACGTCATCT
CTCACCACATCCAGAAGCTGAGGAGGACGGACGCCCAAGGAGGCGAGACGCGGCACAACACGCTCGACACGGGCC
GCGTCTCCCCTGCCGACGATGGCGCGGCCAGGACCCCTGTCCGACTCGTCCAGGCGGTGCTTCTCTACGTCGTCG
GCGCCTGCGGCCACGAGGAAACCGACGACAAGGCTGGCGGCACGGGCTCGACGCACTGCTCCGCGCTCGTGGGTC
TCGCCCAGGCGGCCCGTCTCCTGCAGACCCTCTCCCCGATGAGGCGTGACGTCCAGATGGCCGACGACACGAACT
CGTGCCGTCTCAAGGATCAGGAGGAGCACCGCGATTGGCTGGCATGGAAGAGCGTGGAGGAGCGGAAACGGACGC
TTCACGCCGTCTTCATCGTTTCCAGTCTCCTCGTAGCGGCCTACAACAAGGTGCCGGCACTGACCAACTCGGAAT
TGTCGCTGGATCTTCCCTGCGACGAGGAGTTCTTCGCTGCAGAGTCCAGCGCTGCCTTCACGACACGTGGCGGCG
CCGAGGCTGCGGATCGCAACCGTGTGACTTTCTACGATGCCTTGGGGGCGCTGCTTCGGACAGACGAGAAGCAGC
AGAAGAAGGAGGCCACCGATGACAGCAATGAGACGCCGAGCGACGCGAAGCCGAGCTCATTCGGCTGCCTGATAT
TGATCAACTCCCTCCACAACTACATCTGGGAAACGCGCCAGCGGCACCGCGGCGTGTGGACGGCGGAAGAGACGG
ACAAGATGCACCGACACATCGAGCCCGCCCTCAAGGCGTGGCAGATGGCATGGGCCAGCAACCCGCAACACAGCG
TCGAGCGACCAAACCCCTTTGGCACGGGGCCTCTCTCCGCCGACGCCGTACCGCTCCTCGACCTCGCCTACGTGC
GGCTGTTCGTCGACCTCTCACGATCCAAGGAGAAGTTCTGGCAGCGAGACTGGGTCGGGGTGACGGAGGAGTTGA
CTCGCGCCGGCGGCGTCGCCGAGTGCTCGCAGGCCACCTCTGCCAAGTCCCATGCGATCGACGGCTCAGAGAGGT
CGGCACAGGACGACATCGGGTGCGAAGCGTCGGACCAATCGGCCGCGAGCAGGGAACGGAACCTGAGGAAGGCGG
CTTTCTACGCGGCCGACTCTCTGGCCATGTCTGACCGGCTCGGCGTTACGTTCGTCGACTACACGCGCGGCGAGC
TGCCGCTGCAGTCGGCCCTGTGTACCTTGGACTGCGCCCAGGTGTTGGCCGAATGGATATCGACGCTACAGGACC
GGGTTGGCCGCTACCTGGGAGTGCTCGCGCAGAACCCGGCTGATCTTGGGCAGCTACCTGCCATGGTGCTCCTGG
AGGAGGAAGATGTCAAGCTCTTGGGCAAGGTGCGCGAAATATTGACATCGGCAGAGATGAAGCTTGGCATTGGTC
TGGGGGGAGATTCAATGAGCCTGAGTGGTGACGTCGGGGGCTCGGCCGTTCGGGGCCATGACCGCCTCGGTCTGG
CGGCCAAGCTTCTGCGGATGACGGCGCGGATGCTGGGCCAGGCTGCCGTGTGGCCCTGTGTACGCTCGATGAGCC
GCTGTCTCGAGGTCCATGCCCTTGACGCCCAGGCGAGGGCCGAGCGTTCCGTCGCGCCGCTCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail