Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4821
Gene name
Locationscaffold_387:11045..12596
Strand+
Gene length (bp)1551
Transcript length (bp)1356
Coding sequence length (bp)1353
Protein length (aa) 451

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01467 CTP_transf_like Cytidylyltransferase-like 8.6E-29 170 298

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74975|PCY1_SCHPO Probable choline-phosphate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.02c PE=1 SV=3 155 415 2.0E-93
sp|P13259|PCY1_YEAST Choline-phosphate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCT1 PE=1 SV=2 155 358 1.0E-90
sp|Q9QZC4|PCY1B_RAT Choline-phosphate cytidylyltransferase B OS=Rattus norvegicus GN=Pcyt1b PE=1 SV=1 162 362 4.0E-66
sp|Q811Q9|PCY1B_MOUSE Choline-phosphate cytidylyltransferase B OS=Mus musculus GN=Pcyt1b PE=1 SV=2 162 362 5.0E-66
sp|Q9Y5K3|PCY1B_HUMAN Choline-phosphate cytidylyltransferase B OS=Homo sapiens GN=PCYT1B PE=1 SV=1 162 362 4.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74975|PCY1_SCHPO Probable choline-phosphate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.02c PE=1 SV=3 155 415 2.0E-93
sp|P13259|PCY1_YEAST Choline-phosphate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCT1 PE=1 SV=2 155 358 1.0E-90
sp|Q9QZC4|PCY1B_RAT Choline-phosphate cytidylyltransferase B OS=Rattus norvegicus GN=Pcyt1b PE=1 SV=1 162 362 4.0E-66
sp|Q811Q9|PCY1B_MOUSE Choline-phosphate cytidylyltransferase B OS=Mus musculus GN=Pcyt1b PE=1 SV=2 162 362 5.0E-66
sp|Q9Y5K3|PCY1B_HUMAN Choline-phosphate cytidylyltransferase B OS=Homo sapiens GN=PCYT1B PE=1 SV=1 162 362 4.0E-65
sp|Q9ZV56|CCT1_ARATH Choline-phosphate cytidylyltransferase 1 OS=Arabidopsis thaliana GN=CCT1 PE=1 SV=1 161 373 9.0E-65
sp|P49585|PCY1A_HUMAN Choline-phosphate cytidylyltransferase A OS=Homo sapiens GN=PCYT1A PE=1 SV=2 136 333 2.0E-63
sp|P19836|PCY1A_RAT Choline-phosphate cytidylyltransferase A OS=Rattus norvegicus GN=Pcyt1a PE=1 SV=2 136 333 3.0E-63
sp|P49586|PCY1A_MOUSE Choline-phosphate cytidylyltransferase A OS=Mus musculus GN=Pcyt1a PE=1 SV=1 136 333 5.0E-63
sp|P49584|PCY1A_CRIGR Choline-phosphate cytidylyltransferase A OS=Cricetulus griseus GN=PCYT1A PE=2 SV=1 136 333 4.0E-62
sp|F4JJE0|CCT2_ARATH Choline-phosphate cytidylyltransferase 2 OS=Arabidopsis thaliana GN=CCT2 PE=1 SV=1 165 327 2.0E-61
sp|P49587|PCY1_PLAFK Choline-phosphate cytidylyltransferase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CTP PE=2 SV=1 164 336 1.0E-60
sp|P49583|PCY1_CAEEL Putative choline-phosphate cytidylyltransferase OS=Caenorhabditis elegans GN=F08C6.2 PE=3 SV=2 164 358 1.0E-58
sp|Q55BZ4|PCY2_DICDI Ethanolamine-phosphate cytidylyltransferase OS=Dictyostelium discoideum GN=pctA PE=1 SV=1 165 300 7.0E-30
sp|Q9ZVI9|PECT1_ARATH Ethanolamine-phosphate cytidylyltransferase OS=Arabidopsis thaliana GN=PECT1 PE=1 SV=1 165 300 2.0E-24
sp|Q5EA75|PCY2_BOVIN Ethanolamine-phosphate cytidylyltransferase OS=Bos taurus GN=PCYT2 PE=2 SV=1 153 300 3.0E-23
sp|Q99447|PCY2_HUMAN Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens GN=PCYT2 PE=1 SV=1 153 300 2.0E-22
sp|Q9UTI6|ECT1_SCHPO Probable ethanolamine-phosphate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC15E1.05c PE=2 SV=1 168 300 2.0E-22
sp|Q922E4|PCY2_MOUSE Ethanolamine-phosphate cytidylyltransferase OS=Mus musculus GN=Pcyt2 PE=1 SV=1 165 300 5.0E-22
sp|O88637|PCY2_RAT Ethanolamine-phosphate cytidylyltransferase OS=Rattus norvegicus GN=Pcyt2 PE=1 SV=1 165 300 5.0E-22
sp|P33412|ECT1_YEAST Ethanolamine-phosphate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECT1 PE=1 SV=1 166 300 1.0E-19
sp|Q8SQW6|ECT1_ENCCU Probable ethanolamine-phosphate cytidylyltransferase OS=Encephalitozoon cuniculi (strain GB-M1) GN=MUQ1 PE=1 SV=1 168 300 1.0E-18
sp|Q55BZ4|PCY2_DICDI Ethanolamine-phosphate cytidylyltransferase OS=Dictyostelium discoideum GN=pctA PE=1 SV=1 169 313 6.0E-18
sp|Q922E4|PCY2_MOUSE Ethanolamine-phosphate cytidylyltransferase OS=Mus musculus GN=Pcyt2 PE=1 SV=1 169 313 6.0E-14
sp|Q99447|PCY2_HUMAN Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens GN=PCYT2 PE=1 SV=1 169 313 2.0E-13
sp|O88637|PCY2_RAT Ethanolamine-phosphate cytidylyltransferase OS=Rattus norvegicus GN=Pcyt2 PE=1 SV=1 169 313 3.0E-13
sp|Q9ZVI9|PECT1_ARATH Ethanolamine-phosphate cytidylyltransferase OS=Arabidopsis thaliana GN=PECT1 PE=1 SV=1 169 313 3.0E-13
sp|Q5EA75|PCY2_BOVIN Ethanolamine-phosphate cytidylyltransferase OS=Bos taurus GN=PCYT2 PE=2 SV=1 169 313 7.0E-13
sp|Q8SQW6|ECT1_ENCCU Probable ethanolamine-phosphate cytidylyltransferase OS=Encephalitozoon cuniculi (strain GB-M1) GN=MUQ1 PE=1 SV=1 161 313 5.0E-11
sp|P33412|ECT1_YEAST Ethanolamine-phosphate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECT1 PE=1 SV=1 154 314 2.0E-08
sp|C6A439|RIBL_THESM FAD synthase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=ribL PE=3 SV=1 165 271 3.0E-07
sp|C5A1S7|RIBL_THEGJ FAD synthase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=ribL PE=3 SV=1 161 303 5.0E-07
sp|P27623|TAGD_BACSU Glycerol-3-phosphate cytidylyltransferase OS=Bacillus subtilis (strain 168) GN=tagD PE=1 SV=1 168 299 7.0E-07
sp|Q3A526|HLDE_PELCD Bifunctional protein HldE OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=hldE PE=3 SV=1 169 305 1.0E-06
sp|Q9UZ37|RIBL_PYRAB FAD synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=ribL PE=3 SV=1 165 257 2.0E-06
sp|B6YXC8|RIBL_THEON FAD synthase OS=Thermococcus onnurineus (strain NA1) GN=ribL PE=3 SV=1 165 257 2.0E-06
sp|Q5JHT4|RIBL_THEKO FAD synthase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=ribL PE=3 SV=1 165 303 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2243 0.847 0.0483 0.0324 0.1497 0.0124 0.0829 0.0244 0.0392 0.0039

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1593
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5371
Ophiocordyceps australis map64 (Brazil) OphauB2|3952
Ophiocordyceps camponoti-floridani Ophcf2|00937
Ophiocordyceps camponoti-rufipedis Ophun1|4524
Ophiocordyceps kimflemingae Ophio5|4821 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1221

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4821
MSSASDSHQGGKRKRAAAAAAAAAAAAATADVASTPGASADVVDGALQTSSRDASGEEGDTTAPESGRHHRRNSN
NGAGPNPKRQRANPDRTVDVIDHALDPGEPSDTTEASVDIAERVGRKGRKPVAKEDCDDEDKMEAMAPPPIGRLT
HPAGGFKTNPPPVGRPVRVYADGVFDLFHLGHMRQLEQAKKAFPDTTLVVGVTGNKETHMRKGLTVLSAQERAET
VRHCKWVDEVIEDCPWIVTPEFLEANRLDYVAHDDLPYGADEGDDIYQPIKAAGKFLVTQRTEGVSTTGIITRIV
RDYEKYLTRQFKRGTPRQELNVSWIKKNELDLKRHVQDLRDNIITNWTTTGQELSRELKQFWPASRPQSPARFGS
SGGEAARSPVSSASGPGNSKEFVTGYALGLVGGVRTWMTKNRRTVTDSQHASEDESDEAEERKKSPSQLLLPTPS
A
Coding >Ophio5|4821
ATGTCCTCGGCCTCCGACTCCCATCAGGGTGGCAAACGCAAGAGAGCGGCGGCGGCGGCCGCCGCAGCAGCAGCA
GCAGCAGCAACGGCAGACGTCGCTTCGACCCCCGGTGCTTCGGCAGACGTCGTCGACGGCGCGCTGCAAACTTCG
TCTCGCGATGCTTCGGGCGAAGAAGGTGACACCACGGCCCCCGAGTCCGGCCGTCATCATCGCCGAAACTCCAAC
AACGGCGCCGGCCCAAATCCTAAGCGGCAGAGGGCCAACCCGGACCGCACCGTCGATGTCATCGATCACGCCCTG
GACCCGGGCGAACCGAGCGATACCACCGAGGCCAGTGTCGACATCGCCGAGCGCGTCGGTCGCAAGGGTCGTAAG
CCTGTGGCCAAGGAAGACTGCGACGATGAGGACAAGATGGAGGCGATGGCGCCACCACCCATCGGCAGGCTGACG
CATCCCGCCGGCGGCTTCAAGACGAACCCGCCGCCCGTTGGTCGTCCGGTGCGCGTCTATGCCGACGGCGTCTTT
GATCTGTTCCATCTCGGGCACATGCGTCAACTCGAGCAGGCCAAGAAGGCGTTCCCCGACACCACGCTCGTCGTC
GGCGTCACGGGCAACAAGGAGACGCATATGCGCAAGGGCCTGACCGTGCTCTCTGCCCAGGAGCGCGCCGAGACG
GTCCGACACTGCAAGTGGGTCGACGAGGTCATCGAGGACTGCCCGTGGATCGTGACGCCCGAGTTCCTCGAGGCC
AATCGGCTCGATTACGTCGCCCACGACGATCTTCCGTACGGCGCCGACGAGGGCGACGACATTTACCAGCCCATC
AAAGCTGCCGGCAAGTTCCTCGTCACCCAGCGGACCGAGGGCGTCAGCACCACCGGCATCATCACGAGGATTGTT
CGCGACTACGAAAAGTATCTCACCCGGCAGTTCAAGCGCGGCACTCCGCGGCAGGAACTCAACGTCAGCTGGATC
AAGAAGAACGAGTTGGATCTGAAGCGCCACGTGCAGGACCTGCGGGACAACATCATCACCAACTGGACCACGACG
GGCCAGGAGCTGAGCCGCGAGCTGAAGCAGTTCTGGCCGGCGAGTCGGCCGCAGAGCCCGGCTCGTTTCGGCTCA
TCCGGCGGCGAGGCGGCGCGGTCGCCCGTCAGCTCCGCGTCGGGCCCGGGCAACTCGAAGGAATTCGTCACGGGC
TATGCCCTCGGTCTTGTGGGCGGCGTGCGGACCTGGATGACGAAGAACAGAAGAACGGTTACCGACAGCCAGCAC
GCCAGCGAGGACGAGTCAGATGAAGCCGAGGAACGCAAGAAATCGCCGTCTCAGCTCCTCCTGCCGACGCCCTCA
GCT
Transcript >Ophio5|4821
ATGTCCTCGGCCTCCGACTCCCATCAGGGTGGCAAACGCAAGAGAGCGGCGGCGGCGGCCGCCGCAGCAGCAGCA
GCAGCAGCAACGGCAGACGTCGCTTCGACCCCCGGTGCTTCGGCAGACGTCGTCGACGGCGCGCTGCAAACTTCG
TCTCGCGATGCTTCGGGCGAAGAAGGTGACACCACGGCCCCCGAGTCCGGCCGTCATCATCGCCGAAACTCCAAC
AACGGCGCCGGCCCAAATCCTAAGCGGCAGAGGGCCAACCCGGACCGCACCGTCGATGTCATCGATCACGCCCTG
GACCCGGGCGAACCGAGCGATACCACCGAGGCCAGTGTCGACATCGCCGAGCGCGTCGGTCGCAAGGGTCGTAAG
CCTGTGGCCAAGGAAGACTGCGACGATGAGGACAAGATGGAGGCGATGGCGCCACCACCCATCGGCAGGCTGACG
CATCCCGCCGGCGGCTTCAAGACGAACCCGCCGCCCGTTGGTCGTCCGGTGCGCGTCTATGCCGACGGCGTCTTT
GATCTGTTCCATCTCGGGCACATGCGTCAACTCGAGCAGGCCAAGAAGGCGTTCCCCGACACCACGCTCGTCGTC
GGCGTCACGGGCAACAAGGAGACGCATATGCGCAAGGGCCTGACCGTGCTCTCTGCCCAGGAGCGCGCCGAGACG
GTCCGACACTGCAAGTGGGTCGACGAGGTCATCGAGGACTGCCCGTGGATCGTGACGCCCGAGTTCCTCGAGGCC
AATCGGCTCGATTACGTCGCCCACGACGATCTTCCGTACGGCGCCGACGAGGGCGACGACATTTACCAGCCCATC
AAAGCTGCCGGCAAGTTCCTCGTCACCCAGCGGACCGAGGGCGTCAGCACCACCGGCATCATCACGAGGATTGTT
CGCGACTACGAAAAGTATCTCACCCGGCAGTTCAAGCGCGGCACTCCGCGGCAGGAACTCAACGTCAGCTGGATC
AAGAAGAACGAGTTGGATCTGAAGCGCCACGTGCAGGACCTGCGGGACAACATCATCACCAACTGGACCACGACG
GGCCAGGAGCTGAGCCGCGAGCTGAAGCAGTTCTGGCCGGCGAGTCGGCCGCAGAGCCCGGCTCGTTTCGGCTCA
TCCGGCGGCGAGGCGGCGCGGTCGCCCGTCAGCTCCGCGTCGGGCCCGGGCAACTCGAAGGAATTCGTCACGGGC
TATGCCCTCGGTCTTGTGGGCGGCGTGCGGACCTGGATGACGAAGAACAGAAGAACGGTTACCGACAGCCAGCAC
GCCAGCGAGGACGAGTCAGATGAAGCCGAGGAACGCAAGAAATCGCCGTCTCAGCTCCTCCTGCCGACGCCCTCA
GCTTGA
Gene >Ophio5|4821
ATGTCCTCGGCCTCCGACTCCCATCAGGGTGGCAAACGCAAGAGAGCGGCGGCGGCGGCCGCCGCAGCAGCAGCA
GCAGCAGCAACGGCAGACGTCGCTTCGACCCCCGGTGCTTCGGCAGACGTCGTCGACGGCGCGCTGCAAACTTCG
TCTCGCGATGCTTCGGGCGAAGAAGGTGACACCACGGCCCCCGAGTCCGGCCGTCATCATCGCCGAAACTCCAAC
AACGGCGCCGGCCCAAATCCTAAGCGGCAGAGGGCCAACCCGGACCGCACCGTCGATGTCATCGATCACGCCCTG
GACCCGGGCGAACCGAGCGATACCACCGAGGCCAGTGTCGACATCGCCGAGCGCGTCGGTCGCAAGGGTCGTAAG
CCTGTGGCCAAGGAAGACTGCGACGATGAGGACAAGATGGAGGCGATGGCGCCACCACCCATCGGCAGGCTGACG
CATCCCGCCGGCGGCTTCAAGACGAACCCGCCGCCCGTTGGTCGTCCGGTGCGCGTCTATGCCGACGGCGTCTTT
GATCTGTTCCATCTCGGGCACGTCCATGTCCCCCCTATCTCCGTCCCGTTGCTACCTCTGACCGTAACCATCCTT
GCTCAGGCACATGCGTCAACTCGAGCAGGCCAAGAAGGCGTTCCCCGACACCACGCTCGTCGTCGGCGTCACGGG
CAACAAGGAGACGCATATGCGCAAGGGCCTGACCGTGCTCTCTGCCCAGGAGCGCGCCGAGACGGTCCGACACTG
CAAGTGGGTCGACGAGGTCATCGAGGACTGCCCGTGGATCGTGACGCCCGAGTTCCTCGAGGCCAATCGGCTCGA
TTACGTCGCCCACGACGATCTTCCGTACGGCGCCGACGAGGGCGACGACATTTACCAGCCCATCAAAGCTGCCGG
CAAGTTCCTCGTCACCCAGCGGACCGAGGGCGTCAGCACCACCGGCATCATCACGAGGTCGGTAGCATCCCCTAT
CCTGCTGGGTCGTCTGGGCGTGGATCCTGACGAGTGCCATACAACAGGATTGTTCGCGACTACGAAAAGTATCTC
ACCCGGCAGTTCAAGCGCGGCACTCCGCGGCAGGAACTCAACGTCAGCTGGATCAAGAAGAACGAGTTGGATCTG
AAGCGCCACGTGCAGGACCTGCGGGACAACATCATCACCAACTGGACCACGACGGGCCAGGAGCTGAGCCGCGAG
CTGAAGCAGTTCTGGCCGGCGAGTCGGCCGCAGAGCCCGGCTCGTTTCGGCTCATCCGGCGGCGAGGCGGCGCGG
TCGCCCGTCAGCTCCGCGTCGGGCCCGGGCAACTCGAAGGAATTCGTCACGGGCTATGCCCTCGGTCTTGTGGGC
GGCGTGCGGACCTGGGTAAGGGTGCCCCTATCACCGCTTAACGTGTCCTCATTTCCGAAGGCTGACACCACCTAC
GTGCAGATGACGAAGAACAGAAGAACGGTTACCGACAGCCAGCACGCCAGCGAGGACGAGTCAGATGAAGCCGAG
GAACGCAAGAAATCGCCGTCTCAGCTCCTCCTGCCGACGCCCTCAGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail