Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|482
Gene name
Locationscaffold_111:21501..22734
Strand+
Gene length (bp)1233
Transcript length (bp)1011
Coding sequence length (bp)1008
Protein length (aa) 336

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04756 OST3_OST6 OST3 / OST6 family, transporter family 5.7E-99 45 330

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7ZV50|MAGT1_DANRE Magnesium transporter protein 1 OS=Danio rerio GN=magt1 PE=1 SV=1 45 331 3.0E-31
sp|Q9CQY5|MAGT1_MOUSE Magnesium transporter protein 1 OS=Mus musculus GN=Magt1 PE=1 SV=1 10 331 8.0E-30
sp|Q63ZR0|MAGT1_XENLA Magnesium transporter protein 1 OS=Xenopus laevis GN=magt1 PE=2 SV=1 57 331 4.0E-29
sp|Q5RE31|MAGT1_PONAB Magnesium transporter protein 1 OS=Pongo abelii GN=MAGT1 PE=2 SV=1 12 331 9.0E-28
sp|O35777|MAGT1_RAT Magnesium transporter protein 1 OS=Rattus norvegicus GN=Magt1 PE=2 SV=2 57 331 9.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7ZV50|MAGT1_DANRE Magnesium transporter protein 1 OS=Danio rerio GN=magt1 PE=1 SV=1 45 331 3.0E-31
sp|Q9CQY5|MAGT1_MOUSE Magnesium transporter protein 1 OS=Mus musculus GN=Magt1 PE=1 SV=1 10 331 8.0E-30
sp|Q63ZR0|MAGT1_XENLA Magnesium transporter protein 1 OS=Xenopus laevis GN=magt1 PE=2 SV=1 57 331 4.0E-29
sp|Q5RE31|MAGT1_PONAB Magnesium transporter protein 1 OS=Pongo abelii GN=MAGT1 PE=2 SV=1 12 331 9.0E-28
sp|O35777|MAGT1_RAT Magnesium transporter protein 1 OS=Rattus norvegicus GN=Magt1 PE=2 SV=2 57 331 9.0E-28
sp|Q9H0U3|MAGT1_HUMAN Magnesium transporter protein 1 OS=Homo sapiens GN=MAGT1 PE=1 SV=1 47 331 2.0E-27
sp|Q5ZJ06|MAGT1_CHICK Magnesium transporter protein 1 OS=Gallus gallus GN=MAGT1 PE=2 SV=1 47 331 1.0E-26
sp|Q13454|TUSC3_HUMAN Tumor suppressor candidate 3 OS=Homo sapiens GN=TUSC3 PE=1 SV=1 49 335 2.0E-25
sp|Q8BTV1|TUSC3_MOUSE Tumor suppressor candidate 3 OS=Mus musculus GN=Tusc3 PE=1 SV=1 49 331 3.0E-24
sp|Q8TFH3|OST3_SCHPO Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ost3 PE=3 SV=1 54 330 3.0E-23
sp|Q32L57|TUSC3_BOVIN Tumor suppressor candidate 3 OS=Bos taurus GN=TUSC3 PE=2 SV=1 49 331 6.0E-23
sp|P48439|OST3_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OST3 PE=1 SV=1 49 330 1.0E-19
sp|P34669|OST3_CAEEL Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 OS=Caenorhabditis elegans GN=ZK686.3 PE=3 SV=2 61 331 1.0E-19
sp|Q03723|OST6_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OST6 PE=1 SV=1 78 329 2.0E-13
sp|Q94I55|OST3_ORYSJ Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 3 OS=Oryza sativa subsp. japonica GN=OST3 PE=2 SV=1 49 309 6.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 189 211 22
2 218 240 22
3 266 288 22
4 301 323 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|482
MRILSTLVASACALLAVAAQNNNEEEKAMQKRFTEFHHRLQLAAAPLTLKDSSFNKLTAAPRDYTVAVLLTAQGA
RFGCQLCREFQPEWELTARSWAKGDKAGEARMLFATLDFADGRDTFILLGLQTAPVLLLYPPTHGPHAVSSRDPK
RFDFNSGPPAAEQIHAWVVGHMPGRPHPTFQRPVNYLRWAWTLTILTGLATLAYTAGPYLLPIIQNRQVWAMGTM
IAILLFISGHMFNHIRKVPYVASDGKGGVTYIAPGFQSQYGFETQIVATLYGIMSVCTILLVTRVPRITNRRTQM
WTTLAIVAVMFVTNSFILRIFRIKNSGYPFATPPFM
Coding >Ophio5|482
ATGCGCATCCTCTCGACCCTCGTCGCGTCCGCCTGCGCGCTGCTGGCCGTCGCCGCTCAAAACAATAATGAGGAA
GAAAAGGCTATGCAGAAGCGCTTCACAGAGTTTCACCATCGCCTTCAGCTCGCTGCCGCGCCTCTCACCCTCAAG
GATAGCAGTTTCAATAAGCTCACGGCCGCGCCTCGCGACTATACCGTCGCCGTTCTCCTTACCGCTCAGGGAGCC
CGCTTCGGATGCCAGCTTTGCCGCGAGTTTCAGCCCGAGTGGGAGCTTACTGCTCGGAGCTGGGCCAAGGGCGAC
AAGGCTGGCGAGGCTCGCATGCTCTTCGCCACGCTTGACTTTGCCGATGGCCGTGACACTTTCATCTTGCTCGGT
CTCCAAACCGCCCCCGTTCTCCTCCTTTACCCTCCGACCCATGGCCCCCACGCCGTCTCGTCCCGCGATCCGAAG
CGATTCGATTTCAACAGCGGCCCCCCGGCAGCTGAACAGATCCATGCCTGGGTCGTTGGCCATATGCCGGGTCGT
CCTCATCCCACTTTCCAGCGTCCCGTCAACTACCTGCGATGGGCTTGGACCCTCACCATTCTGACCGGCCTTGCC
ACCTTGGCCTACACTGCGGGGCCCTATCTTCTGCCCATCATCCAGAACCGCCAGGTCTGGGCTATGGGCACCATG
ATTGCCATCCTACTTTTCATCAGCGGACACATGTTCAACCACATCCGCAAGGTGCCCTACGTCGCCAGTGACGGC
AAAGGCGGCGTCACCTACATTGCCCCCGGCTTCCAGAGCCAGTACGGCTTCGAGACGCAGATTGTGGCCACCCTC
TATGGCATCATGTCTGTGTGCACCATCTTACTCGTCACCCGCGTTCCCCGCATCACCAACCGACGAACCCAGATG
TGGACGACCCTAGCCATCGTGGCCGTCATGTTTGTCACGAACAGCTTCATCCTGCGAATCTTCCGCATCAAGAAT
AGCGGATACCCCTTCGCCACCCCGCCCTTCATG
Transcript >Ophio5|482
ATGCGCATCCTCTCGACCCTCGTCGCGTCCGCCTGCGCGCTGCTGGCCGTCGCCGCTCAAAACAATAATGAGGAA
GAAAAGGCTATGCAGAAGCGCTTCACAGAGTTTCACCATCGCCTTCAGCTCGCTGCCGCGCCTCTCACCCTCAAG
GATAGCAGTTTCAATAAGCTCACGGCCGCGCCTCGCGACTATACCGTCGCCGTTCTCCTTACCGCTCAGGGAGCC
CGCTTCGGATGCCAGCTTTGCCGCGAGTTTCAGCCCGAGTGGGAGCTTACTGCTCGGAGCTGGGCCAAGGGCGAC
AAGGCTGGCGAGGCTCGCATGCTCTTCGCCACGCTTGACTTTGCCGATGGCCGTGACACTTTCATCTTGCTCGGT
CTCCAAACCGCCCCCGTTCTCCTCCTTTACCCTCCGACCCATGGCCCCCACGCCGTCTCGTCCCGCGATCCGAAG
CGATTCGATTTCAACAGCGGCCCCCCGGCAGCTGAACAGATCCATGCCTGGGTCGTTGGCCATATGCCGGGTCGT
CCTCATCCCACTTTCCAGCGTCCCGTCAACTACCTGCGATGGGCTTGGACCCTCACCATTCTGACCGGCCTTGCC
ACCTTGGCCTACACTGCGGGGCCCTATCTTCTGCCCATCATCCAGAACCGCCAGGTCTGGGCTATGGGCACCATG
ATTGCCATCCTACTTTTCATCAGCGGACACATGTTCAACCACATCCGCAAGGTGCCCTACGTCGCCAGTGACGGC
AAAGGCGGCGTCACCTACATTGCCCCCGGCTTCCAGAGCCAGTACGGCTTCGAGACGCAGATTGTGGCCACCCTC
TATGGCATCATGTCTGTGTGCACCATCTTACTCGTCACCCGCGTTCCCCGCATCACCAACCGACGAACCCAGATG
TGGACGACCCTAGCCATCGTGGCCGTCATGTTTGTCACGAACAGCTTCATCCTGCGAATCTTCCGCATCAAGAAT
AGCGGATACCCCTTCGCCACCCCGCCCTTCATGTAA
Gene >Ophio5|482
ATGCGCATCCTCTCGACCCTCGTCGCGTCCGCCTGCGCGCTGCTGGCCGTCGCCGCTCAAAACAATAATGAGGAA
GAAAAGGCTATGCAGAAGCGCTTCACAGAGTTTCACCATCGCCTTCAGCTCGCTGCCGCGCCTCTCACCCTCAAG
GATAGCAGTTTCAATAAGCTCACGGCCGCGCCTCGCGACTATACCGTCGCCGTTCTCCTTACCGCTCAGGGAGCC
CGCTTCGGATGCCAGCTTTGCCGCGAGTTTCAGCCCGAGTGGGAGCTTACTGCTCGGAGCTGGGCCAAGGGCGAC
AAGGCTGGCGAGGCTCGCATGCTCTTCGCCACGCTTGACTTTGCCGATGGCCGTGACACTTTCATCTTGGTTGGT
CTTCTTCCCTTTCTTTTCTCTCTTCTTCTTTTCTCTTCCTCGTGCTTCCATCCAGTTTTTGGCTAACCAACTTCT
TACCCTTTCCCCCCCCCCCCCCAGCTCGGTCTCCAAACCGCCCCCGTTCTCCTCCTTTACCCTCCGACCCATGGC
CCCCACGCCGTCTCGTCCCGCGATCCGAAGCGATTCGATTTCAACAGCGGGTCAGTTAACCGGCGTACCATGAAG
CACGCCGGTACCCTACTGACCGAGATCATCGATAGCCCCCCGGCAGCTGAACAGATCCATGCCTGGGTCGTTGGC
CATATGCCGGGTCGTCCTCATCCCACTTTCCAGCGTCCCGTCAACTACCTGCGATGGGCTTGGACCCTCACCATT
CTGACCGGCCTTGCCACCTTGGCCTACACTGCGGGGCCCTATCTTCTGCCCATCATCCAGAACCGCCAGGTCTGG
GCTATGGGCACCATGATTGCCATCCTACTTTTCATCAGCGGACACATGTTCAACCACATCCGCAAGGTGCCCTAC
GTCGCCAGTGACGGCAAAGGCGGCGTCACCTACATTGCCCCCGGCTTCCAGAGCCAGTACGGCTTCGAGACGCAG
ATTGTGGCCACCCTCTGTAAGCCCCTGCCCTCCATTCCCCCCTCCCTCTCCAGCCCAGCTAACGGTGTGGCAGAT
GGCATCATGTCTGTGTGCACCATCTTACTCGTCACCCGCGTTCCCCGCATCACCAACCGACGAACCCAGATGTGG
ACGACCCTAGCCATCGTGGCCGTCATGTTTGTCACGAACAGCTTCATCCTGCGAATCTTCCGCATCAAGAATAGC
GGATACCCCTTCGCCACCCCGCCCTTCATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail