Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4815
Gene name
Locationscaffold_386:11504..12764
Strand+
Gene length (bp)1260
Transcript length (bp)1260
Coding sequence length (bp)1257
Protein length (aa) 419

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02582 DUF155 RMND1/Sif2-Sif3/Mrx10, DUF155 1.3E-45 178 356

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05648|MRX10_YEAST MIOREX complex component 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRX10 PE=1 SV=1 67 401 1.0E-37
sp|Q9NWS8|RMND1_HUMAN Required for meiotic nuclear division protein 1 homolog OS=Homo sapiens GN=RMND1 PE=1 SV=2 132 402 3.0E-32
sp|Q5RAR5|RMND1_PONAB Required for meiotic nuclear division protein 1 homolog OS=Pongo abelii GN=RMND1 PE=2 SV=1 132 402 2.0E-31
sp|Q8CI78|RMND1_MOUSE Required for meiotic nuclear division protein 1 homolog OS=Mus musculus GN=Rmnd1 PE=1 SV=1 121 402 4.0E-30
sp|Q03441|RMD1_YEAST Sporulation protein RMD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD1 PE=1 SV=1 159 403 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05648|MRX10_YEAST MIOREX complex component 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRX10 PE=1 SV=1 67 401 1.0E-37
sp|Q9NWS8|RMND1_HUMAN Required for meiotic nuclear division protein 1 homolog OS=Homo sapiens GN=RMND1 PE=1 SV=2 132 402 3.0E-32
sp|Q5RAR5|RMND1_PONAB Required for meiotic nuclear division protein 1 homolog OS=Pongo abelii GN=RMND1 PE=2 SV=1 132 402 2.0E-31
sp|Q8CI78|RMND1_MOUSE Required for meiotic nuclear division protein 1 homolog OS=Mus musculus GN=Rmnd1 PE=1 SV=1 121 402 4.0E-30
sp|Q03441|RMD1_YEAST Sporulation protein RMD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD1 PE=1 SV=1 159 403 2.0E-19
sp|O74446|SIF2_SCHPO Sad1-interacting factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sif2 PE=1 SV=2 177 400 4.0E-11
sp|P43620|RMD8_YEAST Sporulation protein RMD8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RMD8 PE=1 SV=1 169 402 2.0E-10
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1065 0.0891 0.0435 0.0769 0.791 0.0305 0.0748 0.0484 0.184 0.0031

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1931
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6518
Ophiocordyceps australis map64 (Brazil) OphauB2|7616
Ophiocordyceps camponoti-floridani Ophcf2|00548
Ophiocordyceps camponoti-rufipedis Ophun1|3378
Ophiocordyceps kimflemingae Ophio5|4815 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2065

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4815
MSVAPQRAALISTCRTITAFSVGCRRYLVQPRRQLTTSRRLNLASHGSGGRGGGGGGAGGGGAGGSGGSSSSSTS
ARQHEEAESKVEATSKRKTPRVKATKDSLLRLAIVAQHGKKATDKDVRADPSTVICAICVAEAFKMPVVVEVLAS
HGFAVDPDRLGFDAGEVVHARSANGGDIFVFPSGTVVTWSLPPETISGHLKAAAEAPHAPELCEAEDLDFVVDAS
RADSTMKGDLVILGTRHDHTNPLDTTLAKVAFSSGLARSTKLAVIESALTSYFESTRDIPTLLSRGYGVPYGRRF
ILCKTGELLSLRARLNHYWELTDALPDIFWETKGLEGYYELVGRALDVKVRIQILNQKMDYAQEIATVLREISNE
RHGTRLELIIILLIAVEVIFELRRIYLEPNEESSPVETEEAHLS
Coding >Ophio5|4815
ATGAGCGTTGCTCCGCAGAGGGCTGCCCTCATCTCCACTTGCCGCACAATTACCGCCTTCTCTGTGGGATGTCGC
CGATACTTGGTCCAGCCGCGGCGACAACTGACGACGTCGCGTCGCTTGAACTTGGCCAGTCATGGCTCCGGTGGT
CGTGGCGGCGGCGGCGGCGGGGCCGGAGGAGGGGGTGCGGGCGGGAGCGGGGGCTCGTCGTCCTCGTCGACTTCG
GCTCGGCAGCATGAAGAGGCTGAGTCAAAAGTTGAGGCTACTTCGAAGCGGAAAACTCCGCGGGTGAAAGCGACA
AAGGATTCGCTGCTACGACTCGCCATCGTTGCCCAGCATGGCAAAAAGGCTACGGACAAGGACGTCAGGGCGGAT
CCTTCGACCGTCATCTGCGCCATCTGCGTCGCCGAGGCGTTCAAAATGCCTGTTGTCGTGGAAGTCTTGGCCTCG
CATGGCTTCGCTGTTGATCCTGACCGTCTCGGCTTCGACGCTGGTGAGGTGGTGCATGCCCGGTCCGCCAACGGA
GGCGACATCTTCGTCTTTCCCTCTGGCACCGTCGTCACCTGGTCTTTGCCCCCGGAAACCATCTCGGGCCATCTC
AAGGCCGCCGCCGAGGCGCCCCATGCTCCCGAGCTCTGCGAGGCCGAGGACCTCGACTTTGTCGTCGACGCTTCC
AGAGCGGACAGCACCATGAAGGGTGATCTCGTCATCCTCGGCACCCGACACGATCACACCAACCCCCTCGACACC
ACCCTCGCAAAAGTCGCCTTCTCCTCCGGTCTCGCGCGAAGCACAAAGCTGGCCGTCATCGAGAGCGCCCTGACG
TCCTACTTCGAGAGCACCAGGGACATACCCACCCTCCTGTCCCGCGGTTACGGCGTCCCCTATGGTCGTCGCTTC
ATCCTCTGCAAGACGGGCGAGCTGCTCAGCCTTCGCGCCCGCCTCAATCATTACTGGGAGCTGACCGACGCCCTG
CCCGACATCTTCTGGGAGACAAAGGGCCTCGAGGGCTACTACGAGCTCGTCGGCCGCGCCCTCGACGTAAAGGTC
CGCATCCAGATCCTGAACCAGAAGATGGACTACGCCCAGGAGATTGCCACGGTCCTGCGCGAAATTTCCAACGAG
CGTCACGGCACGCGCCTCGAGCTCATCATCATCCTCCTCATCGCCGTCGAGGTCATCTTTGAACTGCGCCGCATC
TATCTCGAGCCAAACGAGGAGTCGTCCCCCGTCGAGACGGAAGAAGCGCATCTCTCC
Transcript >Ophio5|4815
ATGAGCGTTGCTCCGCAGAGGGCTGCCCTCATCTCCACTTGCCGCACAATTACCGCCTTCTCTGTGGGATGTCGC
CGATACTTGGTCCAGCCGCGGCGACAACTGACGACGTCGCGTCGCTTGAACTTGGCCAGTCATGGCTCCGGTGGT
CGTGGCGGCGGCGGCGGCGGGGCCGGAGGAGGGGGTGCGGGCGGGAGCGGGGGCTCGTCGTCCTCGTCGACTTCG
GCTCGGCAGCATGAAGAGGCTGAGTCAAAAGTTGAGGCTACTTCGAAGCGGAAAACTCCGCGGGTGAAAGCGACA
AAGGATTCGCTGCTACGACTCGCCATCGTTGCCCAGCATGGCAAAAAGGCTACGGACAAGGACGTCAGGGCGGAT
CCTTCGACCGTCATCTGCGCCATCTGCGTCGCCGAGGCGTTCAAAATGCCTGTTGTCGTGGAAGTCTTGGCCTCG
CATGGCTTCGCTGTTGATCCTGACCGTCTCGGCTTCGACGCTGGTGAGGTGGTGCATGCCCGGTCCGCCAACGGA
GGCGACATCTTCGTCTTTCCCTCTGGCACCGTCGTCACCTGGTCTTTGCCCCCGGAAACCATCTCGGGCCATCTC
AAGGCCGCCGCCGAGGCGCCCCATGCTCCCGAGCTCTGCGAGGCCGAGGACCTCGACTTTGTCGTCGACGCTTCC
AGAGCGGACAGCACCATGAAGGGTGATCTCGTCATCCTCGGCACCCGACACGATCACACCAACCCCCTCGACACC
ACCCTCGCAAAAGTCGCCTTCTCCTCCGGTCTCGCGCGAAGCACAAAGCTGGCCGTCATCGAGAGCGCCCTGACG
TCCTACTTCGAGAGCACCAGGGACATACCCACCCTCCTGTCCCGCGGTTACGGCGTCCCCTATGGTCGTCGCTTC
ATCCTCTGCAAGACGGGCGAGCTGCTCAGCCTTCGCGCCCGCCTCAATCATTACTGGGAGCTGACCGACGCCCTG
CCCGACATCTTCTGGGAGACAAAGGGCCTCGAGGGCTACTACGAGCTCGTCGGCCGCGCCCTCGACGTAAAGGTC
CGCATCCAGATCCTGAACCAGAAGATGGACTACGCCCAGGAGATTGCCACGGTCCTGCGCGAAATTTCCAACGAG
CGTCACGGCACGCGCCTCGAGCTCATCATCATCCTCCTCATCGCCGTCGAGGTCATCTTTGAACTGCGCCGCATC
TATCTCGAGCCAAACGAGGAGTCGTCCCCCGTCGAGACGGAAGAAGCGCATCTCTCCTGA
Gene >Ophio5|4815
ATGAGCGTTGCTCCGCAGAGGGCTGCCCTCATCTCCACTTGCCGCACAATTACCGCCTTCTCTGTGGGATGTCGC
CGATACTTGGTCCAGCCGCGGCGACAACTGACGACGTCGCGTCGCTTGAACTTGGCCAGTCATGGCTCCGGTGGT
CGTGGCGGCGGCGGCGGCGGGGCCGGAGGAGGGGGTGCGGGCGGGAGCGGGGGCTCGTCGTCCTCGTCGACTTCG
GCTCGGCAGCATGAAGAGGCTGAGTCAAAAGTTGAGGCTACTTCGAAGCGGAAAACTCCGCGGGTGAAAGCGACA
AAGGATTCGCTGCTACGACTCGCCATCGTTGCCCAGCATGGCAAAAAGGCTACGGACAAGGACGTCAGGGCGGAT
CCTTCGACCGTCATCTGCGCCATCTGCGTCGCCGAGGCGTTCAAAATGCCTGTTGTCGTGGAAGTCTTGGCCTCG
CATGGCTTCGCTGTTGATCCTGACCGTCTCGGCTTCGACGCTGGTGAGGTGGTGCATGCCCGGTCCGCCAACGGA
GGCGACATCTTCGTCTTTCCCTCTGGCACCGTCGTCACCTGGTCTTTGCCCCCGGAAACCATCTCGGGCCATCTC
AAGGCCGCCGCCGAGGCGCCCCATGCTCCCGAGCTCTGCGAGGCCGAGGACCTCGACTTTGTCGTCGACGCTTCC
AGAGCGGACAGCACCATGAAGGGTGATCTCGTCATCCTCGGCACCCGACACGATCACACCAACCCCCTCGACACC
ACCCTCGCAAAAGTCGCCTTCTCCTCCGGTCTCGCGCGAAGCACAAAGCTGGCCGTCATCGAGAGCGCCCTGACG
TCCTACTTCGAGAGCACCAGGGACATACCCACCCTCCTGTCCCGCGGTTACGGCGTCCCCTATGGTCGTCGCTTC
ATCCTCTGCAAGACGGGCGAGCTGCTCAGCCTTCGCGCCCGCCTCAATCATTACTGGGAGCTGACCGACGCCCTG
CCCGACATCTTCTGGGAGACAAAGGGCCTCGAGGGCTACTACGAGCTCGTCGGCCGCGCCCTCGACGTAAAGGTC
CGCATCCAGATCCTGAACCAGAAGATGGACTACGCCCAGGAGATTGCCACGGTCCTGCGCGAAATTTCCAACGAG
CGTCACGGCACGCGCCTCGAGCTCATCATCATCCTCCTCATCGCCGTCGAGGTCATCTTTGAACTGCGCCGCATC
TATCTCGAGCCAAACGAGGAGTCGTCCCCCGTCGAGACGGAAGAAGCGCATCTCTCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail