Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4812
Gene name
Locationscaffold_386:6766..7423
Strand+
Gene length (bp)657
Transcript length (bp)405
Coding sequence length (bp)402
Protein length (aa) 134

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6741 0.6123 0.0384 0.0908 0.1274 0.0119 0.122 0.2688 0.1987 0.1229

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4983
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6515
Ophiocordyceps australis map64 (Brazil) OphauB2|7613
Ophiocordyceps camponoti-rufipedis Ophun1|2246
Ophiocordyceps kimflemingae Ophio5|4812 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2210

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4812
MASVISIPAGRPTVAPSYHGTPKAAGGSSASSYSSSSSPSSPSSTPGTSVVHTRRPSLLSSAISKQQCTVINIGD
PDGPPRLISYLSSSQGFAWNPEIFLPSYVDCDYEPLENQCEPVHEIVLSDEESKELLPQ
Coding >Ophio5|4812
ATGGCGTCCGTCATCAGTATCCCCGCTGGCCGACCGACGGTCGCGCCAAGCTACCACGGCACTCCAAAAGCTGCG
GGTGGCTCGTCGGCGAGCTCCTACTCTAGCTCCTCTTCGCCGTCGTCTCCGTCGTCAACGCCCGGCACCAGCGTG
GTGCACACCCGCCGGCCGAGTCTATTGAGCTCCGCCATCTCCAAACAACAGTGCACCGTCATCAACATCGGCGAC
CCCGACGGGCCCCCTCGACTGATCTCTTACCTGTCGTCGAGCCAAGGCTTTGCCTGGAACCCTGAAATATTCCTT
CCATCCTACGTCGACTGCGACTACGAACCGCTCGAAAACCAATGCGAACCGGTACACGAAATCGTGCTGAGCGAT
GAAGAATCCAAGGAGCTCCTCCCGCAA
Transcript >Ophio5|4812
ATGGCGTCCGTCATCAGTATCCCCGCTGGCCGACCGACGGTCGCGCCAAGCTACCACGGCACTCCAAAAGCTGCG
GGTGGCTCGTCGGCGAGCTCCTACTCTAGCTCCTCTTCGCCGTCGTCTCCGTCGTCAACGCCCGGCACCAGCGTG
GTGCACACCCGCCGGCCGAGTCTATTGAGCTCCGCCATCTCCAAACAACAGTGCACCGTCATCAACATCGGCGAC
CCCGACGGGCCCCCTCGACTGATCTCTTACCTGTCGTCGAGCCAAGGCTTTGCCTGGAACCCTGAAATATTCCTT
CCATCCTACGTCGACTGCGACTACGAACCGCTCGAAAACCAATGCGAACCGGTACACGAAATCGTGCTGAGCGAT
GAAGAATCCAAGGAGCTCCTCCCGCAATGA
Gene >Ophio5|4812
ATGGCGTCCGTCATCAGTATCCCCGCTGGCCGACCGACGGTCGCGCCAAGCTACCACGGCACTCCAAAAGCTGCG
GGTGGCTCGTCGGCGAGCTCCTACTCTAGCTCCTCTTCGCCGTCGTCTCCGTCGTCAACGCCCGGCACCAGCGTG
GTGCACACCCGCCGGCCGAGTCTATTGAGTATGAACACTGCTCCTCTTTCCCCCCCTCTCCTCCCCCCCCTCTAG
AGTCTTTGACTGCCAACGTCGTTTCGCCGATGGGAGCTGGACGGTGCCAAGCCCGGGGAACTGTGTCGGTACTGA
CTGATGTGTCCAGGCTCCGCCATCTCCAAACAACAGTGCACCGTCATCAACATCGGCGACCCCGACGGGCCCCCT
CGACTGGTAGGCGGCTCGTCGGCGTCTTTTAACGCTCATGCGCTGACAGACCCGCCTCCTCAGATCTCTTACCTG
TCGTCGAGCCAAGGCTTTGCCTGGAACCCTGGTACGTGAGCGCTGTATTACGCCCAGCCTTGGTCCACGTGGCTG
ATCCGGGTCCTCCCAGAAATATTCCTTCCATCCTACGTCGACTGCGACTACGAACCGCTCGAAAACCAATGCGAA
CCGGTACACGAAATCGTGCTGAGCGATGAAGAATCCAAGGAGCTCCTCCCGCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail