Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4807
Gene name
Locationscaffold_385:8026..9518
Strand-
Gene length (bp)1492
Transcript length (bp)1425
Coding sequence length (bp)1422
Protein length (aa) 474

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06398 Pex24p Integral peroxisomal membrane peroxin 5.7E-85 76 461

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q03370|PEX29_YEAST Peroxisomal membrane protein PEX29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX29 PE=1 SV=1 30 468 5.0E-47
sp|P38848|PEX28_YEAST Peroxisomal membrane protein PEX28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX28 PE=1 SV=1 21 424 4.0E-30

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

Domain # Start End Length
1 130 152 22
2 233 255 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4807
MTNDQPSPESLSPPSRLRGGLAAIRERAGLQDRLVEKLLQQVIPLDGGGGNDDDDVPDAKASSSSSSSSSSYPQR
PGFNITTMSYNFRHFNARIGVVFRFQAKAERLLSWRRPTQTLSLLAVYSFVCLDPYLLPVLPLVMLLLGVLVPAF
VARHPAPPRGTLSSEQAVGYSPRGPPLAPPAPTVRPPAKDLSRDFFRNMRDLQNSMADFSHARDHIVQLVVPVTD
FSNEALSSTLFLILVASSLVMALAAHVVPWRLIFFVGGWALVLARHPRLKPLLQSQLAPPPHKNQVQDARSLLDR
WTASDVILDSAPETREAEIFELQRADQDAAAWEPWLFSPEPYDPLSPSRIADHRPRGSRFFEDVMPPPGWHWSEK
KWALDLWSREWVEDRIITGVEVETEGERWVYDMFDDRQARTGVVDYSQPPPFKRHADASAQPSWEEGDDGDGGGR
RGEWRRRRWVRLVKRRAVAPSAAA
Coding >Ophio5|4807
ATGACCAACGACCAGCCGTCTCCGGAGTCTTTGTCGCCTCCTTCGAGGCTGCGCGGCGGCCTGGCTGCTATACGC
GAGAGGGCCGGTTTACAGGATCGGTTGGTTGAGAAATTGCTGCAGCAGGTGATTCCCCTCGACGGCGGCGGTGGC
AATGACGACGACGACGTTCCCGACGCCAAAGCCTCGTCGTCGTCGTCGTCGTCGTCATCGTCGTATCCGCAGCGG
CCCGGCTTCAACATTACCACCATGTCGTACAACTTCCGCCACTTCAACGCCCGCATCGGCGTCGTCTTCCGCTTC
CAAGCCAAAGCCGAACGACTACTCTCGTGGCGACGACCGACGCAGACGCTGTCCCTGCTGGCCGTCTACTCCTTC
GTCTGCCTCGACCCTTACCTGCTACCGGTGCTACCGCTCGTGATGCTTCTGCTCGGCGTCCTGGTTCCGGCTTTC
GTGGCTCGTCATCCGGCGCCTCCTCGGGGTACCCTCTCCAGCGAGCAGGCCGTCGGTTACTCTCCTCGTGGTCCG
CCTCTTGCGCCGCCTGCGCCGACGGTGCGACCGCCGGCCAAGGATCTGAGTCGGGACTTTTTTCGGAATATGCGA
GACTTGCAGAATAGCATGGCCGACTTCTCTCACGCCCGTGATCACATCGTCCAGCTCGTCGTGCCCGTCACCGAC
TTTAGCAACGAGGCCCTCTCCTCCACCCTCTTTCTCATCCTCGTCGCCTCCTCCCTCGTCATGGCACTGGCCGCC
CACGTCGTCCCCTGGCGTCTCATCTTCTTCGTCGGCGGCTGGGCCCTCGTCCTCGCGCGCCATCCGCGTCTCAAG
CCTCTCCTGCAAAGCCAGCTTGCACCGCCTCCGCACAAGAATCAAGTACAAGATGCGCGATCCCTTCTCGATCGC
TGGACCGCGTCCGACGTCATCCTCGACTCCGCTCCCGAGACGCGCGAGGCCGAAATCTTCGAGCTCCAACGCGCC
GACCAGGACGCCGCCGCGTGGGAACCCTGGCTCTTCTCTCCCGAACCGTACGATCCGCTCTCGCCGTCTCGCATC
GCCGATCATCGCCCCCGCGGCTCTCGCTTCTTCGAGGACGTCATGCCGCCGCCCGGTTGGCACTGGAGCGAGAAG
AAGTGGGCGCTTGACCTCTGGAGTCGCGAATGGGTCGAGGACCGCATCATCACCGGTGTCGAGGTCGAGACTGAA
GGCGAGCGCTGGGTGTACGACATGTTTGATGACAGGCAGGCTCGCACCGGCGTCGTCGACTACTCTCAACCCCCT
CCCTTCAAGAGGCACGCCGACGCATCGGCTCAGCCTAGCTGGGAGGAGGGCGACGACGGAGACGGCGGCGGAAGG
AGAGGCGAGTGGCGGAGGAGGAGATGGGTAAGGCTGGTTAAGAGGCGAGCCGTTGCGCCGTCGGCCGCAGCC
Transcript >Ophio5|4807
ATGACCAACGACCAGCCGTCTCCGGAGTCTTTGTCGCCTCCTTCGAGGCTGCGCGGCGGCCTGGCTGCTATACGC
GAGAGGGCCGGTTTACAGGATCGGTTGGTTGAGAAATTGCTGCAGCAGGTGATTCCCCTCGACGGCGGCGGTGGC
AATGACGACGACGACGTTCCCGACGCCAAAGCCTCGTCGTCGTCGTCGTCGTCGTCATCGTCGTATCCGCAGCGG
CCCGGCTTCAACATTACCACCATGTCGTACAACTTCCGCCACTTCAACGCCCGCATCGGCGTCGTCTTCCGCTTC
CAAGCCAAAGCCGAACGACTACTCTCGTGGCGACGACCGACGCAGACGCTGTCCCTGCTGGCCGTCTACTCCTTC
GTCTGCCTCGACCCTTACCTGCTACCGGTGCTACCGCTCGTGATGCTTCTGCTCGGCGTCCTGGTTCCGGCTTTC
GTGGCTCGTCATCCGGCGCCTCCTCGGGGTACCCTCTCCAGCGAGCAGGCCGTCGGTTACTCTCCTCGTGGTCCG
CCTCTTGCGCCGCCTGCGCCGACGGTGCGACCGCCGGCCAAGGATCTGAGTCGGGACTTTTTTCGGAATATGCGA
GACTTGCAGAATAGCATGGCCGACTTCTCTCACGCCCGTGATCACATCGTCCAGCTCGTCGTGCCCGTCACCGAC
TTTAGCAACGAGGCCCTCTCCTCCACCCTCTTTCTCATCCTCGTCGCCTCCTCCCTCGTCATGGCACTGGCCGCC
CACGTCGTCCCCTGGCGTCTCATCTTCTTCGTCGGCGGCTGGGCCCTCGTCCTCGCGCGCCATCCGCGTCTCAAG
CCTCTCCTGCAAAGCCAGCTTGCACCGCCTCCGCACAAGAATCAAGTACAAGATGCGCGATCCCTTCTCGATCGC
TGGACCGCGTCCGACGTCATCCTCGACTCCGCTCCCGAGACGCGCGAGGCCGAAATCTTCGAGCTCCAACGCGCC
GACCAGGACGCCGCCGCGTGGGAACCCTGGCTCTTCTCTCCCGAACCGTACGATCCGCTCTCGCCGTCTCGCATC
GCCGATCATCGCCCCCGCGGCTCTCGCTTCTTCGAGGACGTCATGCCGCCGCCCGGTTGGCACTGGAGCGAGAAG
AAGTGGGCGCTTGACCTCTGGAGTCGCGAATGGGTCGAGGACCGCATCATCACCGGTGTCGAGGTCGAGACTGAA
GGCGAGCGCTGGGTGTACGACATGTTTGATGACAGGCAGGCTCGCACCGGCGTCGTCGACTACTCTCAACCCCCT
CCCTTCAAGAGGCACGCCGACGCATCGGCTCAGCCTAGCTGGGAGGAGGGCGACGACGGAGACGGCGGCGGAAGG
AGAGGCGAGTGGCGGAGGAGGAGATGGGTAAGGCTGGTTAAGAGGCGAGCCGTTGCGCCGTCGGCCGCAGCCTGA
Gene >Ophio5|4807
ATGACCAACGACCAGCCGTCTCCGGAGTCTTTGTCGCCTCCTTCGAGGCTGCGCGGCGGCCTGGCTGCTATACGC
GAGAGGGCCGGTTTACAGGATCGGTTGGTTGAGAAGTGCGAATGGGGCCCTTCTATGAGATGGGGAAGGGGATGC
GAATAGTTACTGACCATGGTTATCTAGATTGCTGCAGCAGGTGATTCCCCTCGACGGCGGCGGTGGCAATGACGA
CGACGACGTTCCCGACGCCAAAGCCTCGTCGTCGTCGTCGTCGTCGTCATCGTCGTATCCGCAGCGGCCCGGCTT
CAACATTACCACCATGTCGTACAACTTCCGCCACTTCAACGCCCGCATCGGCGTCGTCTTCCGCTTCCAAGCCAA
AGCCGAACGACTACTCTCGTGGCGACGACCGACGCAGACGCTGTCCCTGCTGGCCGTCTACTCCTTCGTCTGCCT
CGACCCTTACCTGCTACCGGTGCTACCGCTCGTGATGCTTCTGCTCGGCGTCCTGGTTCCGGCTTTCGTGGCTCG
TCATCCGGCGCCTCCTCGGGGTACCCTCTCCAGCGAGCAGGCCGTCGGTTACTCTCCTCGTGGTCCGCCTCTTGC
GCCGCCTGCGCCGACGGTGCGACCGCCGGCCAAGGATCTGAGTCGGGACTTTTTTCGGAATATGCGAGACTTGCA
GAATAGCATGGCCGACTTCTCTCACGCCCGTGATCACATCGTCCAGCTCGTCGTGCCCGTCACCGACTTTAGCAA
CGAGGCCCTCTCCTCCACCCTCTTTCTCATCCTCGTCGCCTCCTCCCTCGTCATGGCACTGGCCGCCCACGTCGT
CCCCTGGCGTCTCATCTTCTTCGTCGGCGGCTGGGCCCTCGTCCTCGCGCGCCATCCGCGTCTCAAGCCTCTCCT
GCAAAGCCAGCTTGCACCGCCTCCGCACAAGAATCAAGTACAAGATGCGCGATCCCTTCTCGATCGCTGGACCGC
GTCCGACGTCATCCTCGACTCCGCTCCCGAGACGCGCGAGGCCGAAATCTTCGAGCTCCAACGCGCCGACCAGGA
CGCCGCCGCGTGGGAACCCTGGCTCTTCTCTCCCGAACCGTACGATCCGCTCTCGCCGTCTCGCATCGCCGATCA
TCGCCCCCGCGGCTCTCGCTTCTTCGAGGACGTCATGCCGCCGCCCGGTTGGCACTGGAGCGAGAAGAAGTGGGC
GCTTGACCTCTGGAGTCGCGAATGGGTCGAGGACCGCATCATCACCGGTGTCGAGGTCGAGACTGAAGGCGAGCG
CTGGGTGTACGACATGTTTGATGACAGGCAGGCTCGCACCGGCGTCGTCGACTACTCTCAACCCCCTCCCTTCAA
GAGGCACGCCGACGCATCGGCTCAGCCTAGCTGGGAGGAGGGCGACGACGGAGACGGCGGCGGAAGGAGAGGCGA
GTGGCGGAGGAGGAGATGGGTAAGGCTGGTTAAGAGGCGAGCCGTTGCGCCGTCGGCCGCAGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail