Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4797
Gene name
Locationscaffold_384:737..2409
Strand+
Gene length (bp)1672
Transcript length (bp)1602
Coding sequence length (bp)1599
Protein length (aa) 533

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03151 TPT Triose-phosphate Transporter family 6.5E-57 121 444

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94695|YG1B_SCHPO Putative transporter C83.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC83.11 PE=1 SV=2 122 500 2.0E-88
sp|P22215|SLY41_YEAST Uncharacterized transporter SLY41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLY41 PE=1 SV=2 118 457 3.0E-44
sp|Q9VR50|S35E1_DROME Solute carrier family 35 member E1 homolog OS=Drosophila melanogaster GN=CG14621 PE=2 SV=1 125 493 5.0E-37
sp|Q84QU8|PPT2_ORYSJ Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT2 PE=2 SV=1 121 446 2.0E-36
sp|Q96K37|S35E1_HUMAN Solute carrier family 35 member E1 OS=Homo sapiens GN=SLC35E1 PE=1 SV=2 121 479 7.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94695|YG1B_SCHPO Putative transporter C83.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC83.11 PE=1 SV=2 122 500 2.0E-88
sp|P22215|SLY41_YEAST Uncharacterized transporter SLY41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLY41 PE=1 SV=2 118 457 3.0E-44
sp|Q9VR50|S35E1_DROME Solute carrier family 35 member E1 homolog OS=Drosophila melanogaster GN=CG14621 PE=2 SV=1 125 493 5.0E-37
sp|Q84QU8|PPT2_ORYSJ Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT2 PE=2 SV=1 121 446 2.0E-36
sp|Q96K37|S35E1_HUMAN Solute carrier family 35 member E1 OS=Homo sapiens GN=SLC35E1 PE=1 SV=2 121 479 7.0E-36
sp|P0C6B1|S35E1_RAT Solute carrier family 35 member E1 OS=Rattus norvegicus GN=Slc35e1 PE=3 SV=1 121 456 9.0E-36
sp|Q69VR7|PPT1_ORYSJ Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT1 PE=2 SV=1 121 446 1.0E-33
sp|Q5VQL3|PPT3_ORYSJ Phosphoenolpyruvate/phosphate translocator 3, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT3 PE=2 SV=1 121 446 1.0E-33
sp|Q8CD26|S35E1_MOUSE Solute carrier family 35 member E1 OS=Mus musculus GN=Slc35e1 PE=1 SV=2 121 456 2.0E-33
sp|P39542|YJT3_YEAST Uncharacterized transporter YJL193W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL193W PE=1 SV=1 100 458 1.0E-29
sp|Q8RXN3|PPT1_ARATH Phosphoenolpyruvate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana GN=PPT1 PE=1 SV=1 97 446 4.0E-28
sp|P52178|TPT2_BRAOB Triose phosphate/phosphate translocator, non-green plastid, chloroplastic OS=Brassica oleracea var. botrytis GN=NGTPT PE=2 SV=1 125 446 8.0E-27
sp|Q8H0T6|PPT2_ARATH Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana GN=PPT2 PE=2 SV=1 128 449 1.0E-24
sp|Q9LF61|XPT_ARATH Xylulose 5-phosphate/phosphate translocator, chloroplastic OS=Arabidopsis thaliana GN=XPT PE=1 SV=1 128 452 5.0E-24
sp|Q9M5A9|GPT1_ARATH Glucose-6-phosphate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana GN=GPT1 PE=2 SV=1 91 447 3.0E-23
sp|P52177|TPT1_BRAOB Triose phosphate/phosphate translocator, chloroplastic OS=Brassica oleracea var. botrytis GN=TPT PE=2 SV=1 125 456 4.0E-22
sp|Q9FTT3|TPT_ORYSJ Triose phosphate/phosphate translocator TPT, chloroplastic OS=Oryza sativa subsp. japonica GN=TPT PE=2 SV=1 127 459 9.0E-22
sp|Q94B38|GPT2_ARATH Glucose-6-phosphate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana GN=GPT2 PE=2 SV=2 129 449 3.0E-21
sp|Q9ZSR7|TPT_ARATH Triose phosphate/phosphate translocator TPT, chloroplastic OS=Arabidopsis thaliana GN=TPT PE=1 SV=1 127 457 6.0E-21
sp|P29463|TPT_SOLTU Triose phosphate/phosphate translocator, chloroplastic OS=Solanum tuberosum GN=TPT PE=2 SV=1 127 457 2.0E-20
sp|P21727|TPT_PEA Triose phosphate/phosphate translocator, chloroplastic OS=Pisum sativum PE=1 SV=1 129 459 2.0E-20
sp|P11869|TPT_SPIOL Triose phosphate/phosphate translocator, chloroplastic OS=Spinacia oleracea PE=1 SV=1 120 456 4.0E-20
sp|P49133|TPT_MAIZE Triose phosphate/phosphate translocator, chloroplastic OS=Zea mays GN=TPT PE=1 SV=1 120 459 7.0E-20
sp|P49132|TPT_FLATR Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria trinervia GN=TPT PE=2 SV=1 127 459 2.0E-18
sp|P49131|TPT_FLAPR Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria pringlei GN=TPT PE=2 SV=1 127 456 2.0E-18
sp|Q8C811|S35E2_MOUSE Solute carrier family 35 member E2 OS=Mus musculus GN=Slc35e2 PE=2 SV=1 220 475 9.0E-16
sp|P0CK96|S352B_HUMAN Solute carrier family 35 member E2B OS=Homo sapiens GN=SLC35E2B PE=2 SV=1 220 471 4.0E-14
sp|Q9SS40|PT310_ARATH Probable sugar phosphate/phosphate translocator At3g10290 OS=Arabidopsis thaliana GN=At3g10290 PE=3 SV=1 105 449 3.0E-12
sp|Q9SFE9|GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana GN=GONST5 PE=2 SV=1 212 475 1.0E-11
sp|Q6DBP3|PT505_ARATH Probable sugar phosphate/phosphate translocator At5g05820 OS=Arabidopsis thaliana GN=At5g05820 PE=2 SV=1 221 452 5.0E-10
sp|Q9C521|UGAL1_ARATH UDP-galactose transporter 1 OS=Arabidopsis thaliana GN=UDP-GALT1 PE=2 SV=1 212 475 1.0E-09
sp|Q5XF09|PT311_ARATH Probable sugar phosphate/phosphate translocator At3g11320 OS=Arabidopsis thaliana GN=At3g11320 PE=2 SV=1 221 452 1.0E-09
sp|Q9FYE5|PT504_ARATH Probable sugar phosphate/phosphate translocator At5g04160 OS=Arabidopsis thaliana GN=At5g04160 PE=2 SV=1 125 447 2.0E-09
sp|Q9LDH3|PT112_ARATH Probable sugar phosphate/phosphate translocator At1g12500 OS=Arabidopsis thaliana GN=At1g12500 PE=1 SV=1 192 452 5.0E-08
sp|Q9SKJ7|PT225_ARATH Probable sugar phosphate/phosphate translocator At2g25520 OS=Arabidopsis thaliana GN=At2g25520 PE=1 SV=1 150 481 8.0E-08
sp|Q9LFN3|PT511_ARATH Probable sugar phosphate/phosphate translocator At5g11230 OS=Arabidopsis thaliana GN=At5g11230 PE=2 SV=1 150 466 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

Domain # Start End Length
1 153 175 22
2 196 213 17
3 223 245 22
4 252 269 17
5 279 298 19
6 325 347 22
7 383 405 22
8 412 434 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 73.87 40.26 107.48
CcL In ants, during behavior modification 73.07 38.98 107.16
CcD In ants, recently dead 49.58 27.17 71.98

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.970226 no
SC16a CcD 0.077162 no
CcL CcD 0.093644 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4797
MAMEKFPDHVDTLSSFTTQGPPPSKHCQPNGNDMANGIGNGNGFGNGFEKPASSLLTDRWTPRRDEGHGGSGASR
SGTSRGGRHRQKSLSDAFRTIRSRNGSVSQNAHEIADALRAPVSPKLVALCLLWYTSSALTNTSSKSILIAFDKP
ATLTLVQFAFVSSLCIILAWLASLFPVLQSSIAVLRHPIRRPSAHVISNTLPLAAFQIGGHLLSSTATAKIPVSL
VHTIKGLSPLFTVLAYRIFYDIQYPQATYLSLVPLTSGVMLACSGKASYDGQLLGVVQALLATLIFVTQNIVSKK
IFNEAAKVEAEAPGMESRKLDKLNLLCYSSGMAFIVTLPIWFWTEGIALLGDVLHDGAIDLSNHPLAMDHGRLTL
EFIFNGVFHFSQNMLAFILLSMVSPVTYSVASLIKRVFVIVMAIVWFRSPTTPVQAVGIALTFLGLYLYDRSSES
NKADRKARSIAQSRSGTPLLPLNEKPARGGDGSPNPSADSSAHLYTEGYLGSAAASHDPKKSDGRVGRGRSERSS
TTGWLPRQ
Coding >Ophio5|4797
ATGGCCATGGAAAAGTTCCCCGACCACGTCGATACCTTGTCGTCCTTCACGACTCAGGGACCTCCTCCGTCCAAG
CATTGCCAACCCAACGGCAACGACATGGCCAATGGCATCGGTAACGGAAACGGCTTCGGCAATGGCTTCGAAAAG
CCTGCCTCGTCACTGCTGACGGACCGCTGGACGCCGAGGCGCGATGAGGGACACGGTGGCAGCGGCGCGTCCCGG
TCTGGCACGTCTCGCGGAGGCCGCCACCGCCAGAAGAGCCTGAGCGACGCCTTTCGCACCATTCGATCAAGAAAT
GGGAGCGTGAGCCAGAACGCCCACGAAATCGCCGATGCACTGCGGGCCCCCGTGTCTCCCAAGCTCGTCGCCCTC
TGTCTACTCTGGTACACGTCGTCGGCACTGACAAACACGTCGTCCAAATCCATCCTCATCGCCTTCGACAAGCCG
GCGACCCTCACCCTCGTCCAGTTCGCCTTCGTGTCCTCGCTCTGCATTATCCTTGCCTGGCTGGCCAGCCTCTTC
CCCGTTCTGCAGTCTTCAATCGCCGTTCTCCGGCACCCCATTCGCCGACCGAGTGCCCACGTCATCTCCAACACG
CTCCCTCTTGCCGCCTTTCAGATTGGCGGCCACCTCTTGAGCTCGACTGCCACCGCCAAGATCCCCGTGTCCCTC
GTTCACACCATCAAGGGCCTGTCCCCTTTGTTCACCGTCCTGGCCTATAGGATCTTCTACGACATTCAGTACCCC
CAAGCCACCTACCTGTCCCTCGTGCCCTTGACGAGCGGTGTCATGCTCGCCTGTTCGGGAAAGGCCTCTTACGAC
GGGCAGCTCCTCGGTGTGGTGCAGGCGCTCTTGGCCACACTCATCTTCGTCACTCAAAACATTGTATCCAAGAAA
ATCTTCAACGAGGCCGCAAAGGTCGAGGCCGAAGCTCCCGGCATGGAGTCGAGGAAACTAGACAAGCTCAATCTC
CTCTGCTACTCTTCCGGCATGGCTTTTATCGTCACCCTACCCATTTGGTTCTGGACAGAGGGCATTGCTCTCCTT
GGTGATGTCCTGCACGACGGCGCCATTGATCTGAGCAACCACCCTCTCGCCATGGATCACGGCCGTCTGACTCTC
GAGTTCATTTTCAACGGTGTCTTCCACTTCAGCCAAAATATGTTGGCCTTTATCCTGCTGTCCATGGTCTCGCCC
GTCACCTACTCCGTCGCCAGCCTGATCAAGAGGGTTTTCGTCATCGTCATGGCCATCGTCTGGTTCAGGAGTCCG
ACGACGCCCGTCCAGGCTGTGGGCATTGCTCTCACCTTCCTCGGCCTATATCTGTACGACCGCTCGAGTGAAAGC
AACAAGGCTGACCGCAAGGCGCGCTCCATTGCCCAGTCACGCAGCGGGACGCCTCTGCTGCCGCTCAACGAGAAG
CCGGCCAGGGGCGGTGATGGCAGCCCCAACCCGTCGGCGGATTCCAGCGCACACCTCTACACCGAAGGCTACTTG
GGATCGGCCGCTGCCAGTCACGACCCTAAGAAGTCGGATGGCAGGGTTGGCCGGGGCCGCTCTGAACGCAGCAGC
ACAACGGGGTGGCTACCGCGCCAA
Transcript >Ophio5|4797
ATGGCCATGGAAAAGTTCCCCGACCACGTCGATACCTTGTCGTCCTTCACGACTCAGGGACCTCCTCCGTCCAAG
CATTGCCAACCCAACGGCAACGACATGGCCAATGGCATCGGTAACGGAAACGGCTTCGGCAATGGCTTCGAAAAG
CCTGCCTCGTCACTGCTGACGGACCGCTGGACGCCGAGGCGCGATGAGGGACACGGTGGCAGCGGCGCGTCCCGG
TCTGGCACGTCTCGCGGAGGCCGCCACCGCCAGAAGAGCCTGAGCGACGCCTTTCGCACCATTCGATCAAGAAAT
GGGAGCGTGAGCCAGAACGCCCACGAAATCGCCGATGCACTGCGGGCCCCCGTGTCTCCCAAGCTCGTCGCCCTC
TGTCTACTCTGGTACACGTCGTCGGCACTGACAAACACGTCGTCCAAATCCATCCTCATCGCCTTCGACAAGCCG
GCGACCCTCACCCTCGTCCAGTTCGCCTTCGTGTCCTCGCTCTGCATTATCCTTGCCTGGCTGGCCAGCCTCTTC
CCCGTTCTGCAGTCTTCAATCGCCGTTCTCCGGCACCCCATTCGCCGACCGAGTGCCCACGTCATCTCCAACACG
CTCCCTCTTGCCGCCTTTCAGATTGGCGGCCACCTCTTGAGCTCGACTGCCACCGCCAAGATCCCCGTGTCCCTC
GTTCACACCATCAAGGGCCTGTCCCCTTTGTTCACCGTCCTGGCCTATAGGATCTTCTACGACATTCAGTACCCC
CAAGCCACCTACCTGTCCCTCGTGCCCTTGACGAGCGGTGTCATGCTCGCCTGTTCGGGAAAGGCCTCTTACGAC
GGGCAGCTCCTCGGTGTGGTGCAGGCGCTCTTGGCCACACTCATCTTCGTCACTCAAAACATTGTATCCAAGAAA
ATCTTCAACGAGGCCGCAAAGGTCGAGGCCGAAGCTCCCGGCATGGAGTCGAGGAAACTAGACAAGCTCAATCTC
CTCTGCTACTCTTCCGGCATGGCTTTTATCGTCACCCTACCCATTTGGTTCTGGACAGAGGGCATTGCTCTCCTT
GGTGATGTCCTGCACGACGGCGCCATTGATCTGAGCAACCACCCTCTCGCCATGGATCACGGCCGTCTGACTCTC
GAGTTCATTTTCAACGGTGTCTTCCACTTCAGCCAAAATATGTTGGCCTTTATCCTGCTGTCCATGGTCTCGCCC
GTCACCTACTCCGTCGCCAGCCTGATCAAGAGGGTTTTCGTCATCGTCATGGCCATCGTCTGGTTCAGGAGTCCG
ACGACGCCCGTCCAGGCTGTGGGCATTGCTCTCACCTTCCTCGGCCTATATCTGTACGACCGCTCGAGTGAAAGC
AACAAGGCTGACCGCAAGGCGCGCTCCATTGCCCAGTCACGCAGCGGGACGCCTCTGCTGCCGCTCAACGAGAAG
CCGGCCAGGGGCGGTGATGGCAGCCCCAACCCGTCGGCGGATTCCAGCGCACACCTCTACACCGAAGGCTACTTG
GGATCGGCCGCTGCCAGTCACGACCCTAAGAAGTCGGATGGCAGGGTTGGCCGGGGCCGCTCTGAACGCAGCAGC
ACAACGGGGTGGCTACCGCGCCAATGA
Gene >Ophio5|4797
ATGGCCATGGAAAAGTTCCCCGACCACGTCGATACCTTGTCGTCCTTCACGACTCAGGGACCTCCTCCGTCCAAG
CATTGCCAACCCAACGGCAACGACATGGCCAATGGCATCGGTAACGGAAACGGCTTCGGCAATGGCTTCGAAAAG
CCTGCCTCGTCACTGCTGACGGACCGCTGGACGCCGAGGCGCGATGAGGGACACGGTGGCAGCGGCGCGTCCCGG
TCTGGCACGTCTCGCGGAGGCCGCCACCGCCAGAAGAGCCTGAGCGACGCCTTTCGCACCATTCGATCAAGAAAT
GGGAGCGTGAGCCAGAACGCCCACGAAATCGCCGATGCACTGCGGGCCCCCGTGTCTCCCAAGCTCGTCGTTCGT
TTGATCCATCCATATCCATTCATTCCCATCGTCAACCGCTGACGGCTGCTTCCTCGCCCGCCAGGCCCTCTGTCT
ACTCTGGTACACGTCGTCGGCACTGACAAACACGTCGTCCAAATCCATCCTCATCGCCTTCGACAAGCCGGCGAC
CCTCACCCTCGTCCAGTTCGCCTTCGTGTCCTCGCTCTGCATTATCCTTGCCTGGCTGGCCAGCCTCTTCCCCGT
TCTGCAGTCTTCAATCGCCGTTCTCCGGCACCCCATTCGCCGACCGAGTGCCCACGTCATCTCCAACACGCTCCC
TCTTGCCGCCTTTCAGATTGGCGGCCACCTCTTGAGCTCGACTGCCACCGCCAAGATCCCCGTGTCCCTCGTTCA
CACCATCAAGGGCCTGTCCCCTTTGTTCACCGTCCTGGCCTATAGGATCTTCTACGACATTCAGTACCCCCAAGC
CACCTACCTGTCCCTCGTGCCCTTGACGAGCGGTGTCATGCTCGCCTGTTCGGGAAAGGCCTCTTACGACGGGCA
GCTCCTCGGTGTGGTGCAGGCGCTCTTGGCCACACTCATCTTCGTCACTCAAAACATTGTATCCAAGAAAATCTT
CAACGAGGCCGCAAAGGTCGAGGCCGAAGCTCCCGGCATGGAGTCGAGGAAACTAGACAAGCTCAATCTCCTCTG
CTACTCTTCCGGCATGGCTTTTATCGTCACCCTACCCATTTGGTTCTGGACAGAGGGCATTGCTCTCCTTGGTGA
TGTCCTGCACGACGGCGCCATTGATCTGAGCAACCACCCTCTCGCCATGGATCACGGCCGTCTGACTCTCGAGTT
CATTTTCAACGGTGTCTTCCACTTCAGCCAAAATATGTTGGCCTTTATCCTGCTGTCCATGGTCTCGCCCGTCAC
CTACTCCGTCGCCAGCCTGATCAAGAGGGTTTTCGTCATCGTCATGGCCATCGTCTGGTTCAGGAGTCCGACGAC
GCCCGTCCAGGCTGTGGGCATTGCTCTCACCTTCCTCGGCCTATATCTGTACGACCGCTCGAGTGAAAGCAACAA
GGCTGACCGCAAGGCGCGCTCCATTGCCCAGTCACGCAGCGGGACGCCTCTGCTGCCGCTCAACGAGAAGCCGGC
CAGGGGCGGTGATGGCAGCCCCAACCCGTCGGCGGATTCCAGCGCACACCTCTACACCGAAGGCTACTTGGGATC
GGCCGCTGCCAGTCACGACCCTAAGAAGTCGGATGGCAGGGTTGGCCGGGGCCGCTCTGAACGCAGCAGCACAAC
GGGGTGGCTACCGCGCCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail