Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4796
Gene name
Locationscaffold_383:17921..19806
Strand-
Gene length (bp)1885
Transcript length (bp)1479
Coding sequence length (bp)1476
Protein length (aa) 492

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.8E-35 71 443
PF00083 Sugar_tr Sugar (and other) transporter 1.2E-09 97 236

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 47 455 8.0E-26
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 45 455 7.0E-21
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 45 455 2.0E-20
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 18 250 2.0E-20
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 47 454 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 47 455 8.0E-26
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 45 455 7.0E-21
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 45 455 2.0E-20
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 18 250 2.0E-20
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 47 454 1.0E-17
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 33 455 4.0E-15
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 47 220 8.0E-15
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 4 455 2.0E-14
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 49 240 4.0E-14
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 34 353 1.0E-13
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 38 242 3.0E-13
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 47 437 4.0E-13
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 2 240 5.0E-12
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 26 363 5.0E-12
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 38 455 6.0E-12
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 47 415 8.0E-12
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 47 415 8.0E-12
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 47 439 8.0E-12
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 47 454 2.0E-11
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 6 454 4.0E-10
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 47 352 4.0E-10
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 46 240 2.0E-09
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 83 252 2.0E-08
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 87 232 9.0E-08
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 46 454 9.0E-08
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 83 332 1.0E-07
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 4 455 1.0E-07
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 46 240 4.0E-07
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 13 240 5.0E-07
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 4 444 2.0E-06
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 48 430 8.0E-06
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 37 243 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 63 85 22
2 98 120 22
3 127 144 17
4 154 176 22
5 189 211 22
6 215 237 22
7 282 304 22
8 319 341 22
9 362 381 19
10 424 446 22
11 453 475 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4796
MSLSGSNKAEKASHDGASETSWLAGDHRQFLLDRHGTIELHPVPCMDPHDPLNWSTAKKATNLILVSFHAMMFSF
TAAAIQCAFVDIAHDLGVSVQKASYLTSLFIGILGVSALFWAPLSHTFGRRPVFLLSLTGSLVGNVGCGLSRRSY
AAMAVSRALTAFFVSPTGALGTAVVSEMFFHRDRGRCMGVWTVMTTLGVPLAPLVFGFAALRVGYRWIYWTLTIT
NVVQIILHWFFGSETRYEPTKTPSRLRYWPWLRRIDPQPLSWFEFVRPLTFVRRGRVAIAAASFAVVFLWGSIMV
TLEIPQIFPAKFGLNTQDIGLQNLAIIVGTLGGELIGGFASDKWMHLRERKGKRPCSAEFRLWLSHVGYMLTILG
VAVFFAQLDRASDVWDVSPLLGVALAAAGNQMVTTILMTYTVDCYPADATAVGAFLNFVRLTWGFLGPFWFPQMI
ENLGFVRSIAVPTVMILVVSVLPTLVLQWKGPEWDGERREDG
Coding >Ophio5|4796
ATGAGCCTGTCCGGGAGCAACAAGGCTGAAAAGGCCAGCCACGACGGCGCTAGTGAGACGAGCTGGCTGGCTGGC
GACCATCGGCAGTTTCTCCTCGACCGCCATGGCACCATCGAGCTGCACCCTGTGCCGTGCATGGATCCTCACGAT
CCCCTCAACTGGTCGACTGCTAAGAAAGCGACAAACCTCATCCTCGTCTCTTTCCACGCCATGATGTTCTCCTTC
ACGGCCGCCGCCATCCAATGCGCCTTCGTCGACATCGCCCATGACCTAGGGGTGAGCGTCCAGAAAGCCAGCTAC
CTCACCTCCCTCTTCATCGGCATCCTAGGCGTCTCAGCACTCTTCTGGGCGCCACTATCGCACACCTTCGGCCGA
CGACCCGTCTTCCTCCTCTCCCTGACCGGATCGCTCGTCGGCAACGTCGGCTGCGGTCTAAGCCGACGGTCGTAC
GCGGCCATGGCCGTCAGTCGTGCTCTGACGGCCTTCTTCGTCAGTCCGACCGGAGCGCTCGGGACGGCCGTCGTG
TCGGAAATGTTCTTCCATCGCGATAGGGGCCGTTGCATGGGTGTGTGGACGGTCATGACCACCTTGGGCGTTCCC
TTGGCGCCTTTGGTTTTTGGCTTTGCCGCTTTGAGGGTCGGTTATCGTTGGATTTATTGGACTTTGACTATTACA
AACGTCGTCCAGATCATCCTTCACTGGTTCTTCGGGTCCGAGACGAGATACGAGCCGACAAAGACGCCGTCGCGT
CTTCGATATTGGCCATGGCTACGACGAATCGACCCCCAGCCCCTATCATGGTTCGAATTCGTCCGACCCCTAACG
TTTGTGAGACGGGGCCGGGTCGCCATCGCAGCCGCATCCTTCGCCGTCGTCTTCCTCTGGGGCAGCATCATGGTG
ACGCTCGAGATTCCGCAAATCTTCCCCGCCAAGTTTGGACTCAACACGCAGGACATTGGCTTGCAGAACCTGGCC
ATCATCGTCGGTACTCTGGGCGGCGAGCTCATCGGCGGCTTCGCTTCCGATAAGTGGATGCATCTGCGGGAGCGG
AAAGGGAAAAGACCTTGTTCGGCCGAGTTTCGGCTCTGGCTGAGCCATGTGGGATACATGCTCACCATCCTCGGT
GTTGCCGTCTTCTTCGCTCAGTTGGATAGGGCGTCGGACGTGTGGGATGTCAGTCCGCTGCTGGGCGTTGCCCTC
GCCGCTGCGGGAAACCAGATGGTGACGACGATTCTGATGACGTATACGGTCGATTGCTACCCGGCCGATGCCACC
GCCGTCGGCGCCTTTCTCAACTTTGTCCGTCTGACGTGGGGATTCCTGGGACCTTTTTGGTTCCCGCAGATGATT
GAGAACCTCGGCTTCGTCCGGAGCATAGCCGTACCGACCGTCATGATACTCGTCGTCTCGGTGCTGCCCACGCTG
GTGCTACAATGGAAAGGCCCAGAGTGGGATGGAGAGAGGAGAGAAGACGGA
Transcript >Ophio5|4796
ATGAGCCTGTCCGGGAGCAACAAGGCTGAAAAGGCCAGCCACGACGGCGCTAGTGAGACGAGCTGGCTGGCTGGC
GACCATCGGCAGTTTCTCCTCGACCGCCATGGCACCATCGAGCTGCACCCTGTGCCGTGCATGGATCCTCACGAT
CCCCTCAACTGGTCGACTGCTAAGAAAGCGACAAACCTCATCCTCGTCTCTTTCCACGCCATGATGTTCTCCTTC
ACGGCCGCCGCCATCCAATGCGCCTTCGTCGACATCGCCCATGACCTAGGGGTGAGCGTCCAGAAAGCCAGCTAC
CTCACCTCCCTCTTCATCGGCATCCTAGGCGTCTCAGCACTCTTCTGGGCGCCACTATCGCACACCTTCGGCCGA
CGACCCGTCTTCCTCCTCTCCCTGACCGGATCGCTCGTCGGCAACGTCGGCTGCGGTCTAAGCCGACGGTCGTAC
GCGGCCATGGCCGTCAGTCGTGCTCTGACGGCCTTCTTCGTCAGTCCGACCGGAGCGCTCGGGACGGCCGTCGTG
TCGGAAATGTTCTTCCATCGCGATAGGGGCCGTTGCATGGGTGTGTGGACGGTCATGACCACCTTGGGCGTTCCC
TTGGCGCCTTTGGTTTTTGGCTTTGCCGCTTTGAGGGTCGGTTATCGTTGGATTTATTGGACTTTGACTATTACA
AACGTCGTCCAGATCATCCTTCACTGGTTCTTCGGGTCCGAGACGAGATACGAGCCGACAAAGACGCCGTCGCGT
CTTCGATATTGGCCATGGCTACGACGAATCGACCCCCAGCCCCTATCATGGTTCGAATTCGTCCGACCCCTAACG
TTTGTGAGACGGGGCCGGGTCGCCATCGCAGCCGCATCCTTCGCCGTCGTCTTCCTCTGGGGCAGCATCATGGTG
ACGCTCGAGATTCCGCAAATCTTCCCCGCCAAGTTTGGACTCAACACGCAGGACATTGGCTTGCAGAACCTGGCC
ATCATCGTCGGTACTCTGGGCGGCGAGCTCATCGGCGGCTTCGCTTCCGATAAGTGGATGCATCTGCGGGAGCGG
AAAGGGAAAAGACCTTGTTCGGCCGAGTTTCGGCTCTGGCTGAGCCATGTGGGATACATGCTCACCATCCTCGGT
GTTGCCGTCTTCTTCGCTCAGTTGGATAGGGCGTCGGACGTGTGGGATGTCAGTCCGCTGCTGGGCGTTGCCCTC
GCCGCTGCGGGAAACCAGATGGTGACGACGATTCTGATGACGTATACGGTCGATTGCTACCCGGCCGATGCCACC
GCCGTCGGCGCCTTTCTCAACTTTGTCCGTCTGACGTGGGGATTCCTGGGACCTTTTTGGTTCCCGCAGATGATT
GAGAACCTCGGCTTCGTCCGGAGCATAGCCGTACCGACCGTCATGATACTCGTCGTCTCGGTGCTGCCCACGCTG
GTGCTACAATGGAAAGGCCCAGAGTGGGATGGAGAGAGGAGAGAAGACGGATGA
Gene >Ophio5|4796
ATGAGCCTGTCCGGGAGCAACAAGGCTGAAAAGGCCAGCCACGACGGCGCTGTGAGTCTTCCTCTCTCTCTCTCT
CTCTCTCTCACTTCTTTTTTTTTTCTTTTTCTTTTCCTTTGTTCCTCCAAGGCCTTTTTCTTGTGCTTAACGATT
GCAAAGAGTGAGACGAGCTGGCTGGCTGGCGACCATCGGCAGTTTCTCCTCGACCGCCATGGCACCATCGAGCTG
CACCCTGTGCCGTGCATGGATCCTCACGATCCCCTCAACTGGTCGACTGCTAAGGTAAAAAAAAAACAAAAAAAA
AGGGAGGGAGAGAAAGGATGAATGATTCCAAAATAAGAATGACCCGGGAAATGCTGAAGACTGATAGAAAGCGAC
AAACCTCATCCTCGTCTCTTTCCACGCCATGATGTTCTCCTTCACGGCCGCCGCCATCCAATGCGCCTTCGTCGA
CATCGCCCATGACCTAGGGGTGAGCGTCCAGAAAGCCAGCTACCTCACCTCCCTCTTCATCGGCATCCTAGGCGT
CTCAGCACTCTTCTGGGCGCCACTATCGCACACCTTCGGCCGACGACCCGTCTTCCTCCTCTCCCTGACCGGATC
GCTCGTCGGCAACGTCGGCTGCGGTCTAAGCCGACGGTCGTACGCGGCCATGGCCGTCAGTCGTGCTCTGACGGC
CTTCTTCGTCAGTCCGACCGGAGCGCTCGGGACGGCCGTCGTGTCGGAAATGTTCTTCCATCGCGATAGGGGCCG
TTGCATGGGTGTGTGGACGGTCATGACCACCTTGGGCGTTCCCTTGGCGCCTTTGGTTTTTGGCTTTGCCGCTTT
GAGGGTCGGTTATCGTTGGATTTATTGGACTTTGACTATTGTAGGTGCTTCTTTTTGCTTTTCGTCTTTTTGGAG
AAAGAGAGGAAGAGAGAGAGAGAGACAGAGAGAGAAAGAGAGAGAGAGAGTTAGCTTTCTTACCTTATCCTTCCC
CCTTTTCCCCCCCTTTCCTTTAGACAAACGTCGTCCAGATCATCCTTCACTGGTTCTTCGGGTCCGAGACGAGAT
ACGAGCCGACAAAGACGCCGTCGCGTCTTCGATATTGGCCATGGCTACGACGAATCGACCCCCAGCCCCTATCAT
GGTTCGAATTCGTCCGACCCCTAACGTTTGTGAGACGGGGCCGGGTCGCCATCGCAGCCGCATCCTTCGCCGTCG
TCTTCCTCTGGGGCAGCATCATGGTGACGCTCGAGATTCCGCAAATCTTCCCCGCCAAGTTTGGACTCAACACGC
AGGACATTGGCTTGCAGAACCTGGCCATCATCGTCGGTACTCTGGGCGGCGAGCTCATCGGCGGCTTCGCTTCCG
ATAAGTGGATGCATCTGCGGGAGCGGAAAGGGAAAAGACCTTGTTCGGCCGAGTTTCGGCTCTGGCTGAGCCATG
TGGGATACATGCTCACCATCCTCGGTGTTGCCGTCTTCTTCGCTCAGTTGGATAGGGCGTCGGACGTGTGGGATG
TCAGTCCGCTGCTGGGCGTTGCCCTCGCCGCTGCGGGAAACCAGATGGTGACGACGATTCTGATGACGTATACGG
TCGATTGCTACCCGGCCGATGCCACCGCCGTCGGCGCCTTTCTCAACTTTGTCCGTCTGACGTGGGGATTCCTGG
GACCTTTTTGGTGCGGGCCTTTTTTTTCCCCTTTTCTGTTTATACGGTATAGGAAAGCGCAAAAGTTGCTGATGA
ATGAAGCCTGTGTAGGTTCCCGCAGATGATTGAGAACCTCGGCTTCGTCCGGAGCATAGCCGTACCGACCGTCAT
GATACTCGTCGTCTCGGTGCTGCCCACGCTGGTGCTACAATGGAAAGGCCCAGAGTGGGATGGAGAGAGGAGAGA
AGACGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail