Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4795
Gene name
Locationscaffold_383:16313..17514
Strand-
Gene length (bp)1201
Transcript length (bp)1131
Coding sequence length (bp)1128
Protein length (aa) 376

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07732 Cu-oxidase_3 Multicopper oxidase 2.9E-37 101 216
PF00394 Cu-oxidase Multicopper oxidase 5.2E-13 230 361

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P14133|ASO_CUCSA L-ascorbate oxidase OS=Cucumis sativus PE=1 SV=1 91 369 4.0E-44
sp|P37064|ASO_CUCPM L-ascorbate oxidase OS=Cucurbita pepo var. melopepo PE=1 SV=1 96 363 5.0E-44
sp|P24792|ASO_CUCMA L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=1 SV=2 96 363 1.0E-43
sp|Q40588|ASO_TOBAC L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE=2 SV=1 96 362 7.0E-39
sp|Q02079|LAC3_THACU Laccase-3 OS=Thanatephorus cucumeris GN=LCC3 PE=2 SV=1 96 362 2.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P14133|ASO_CUCSA L-ascorbate oxidase OS=Cucumis sativus PE=1 SV=1 91 369 4.0E-44
sp|P37064|ASO_CUCPM L-ascorbate oxidase OS=Cucurbita pepo var. melopepo PE=1 SV=1 96 363 5.0E-44
sp|P24792|ASO_CUCMA L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=1 SV=2 96 363 1.0E-43
sp|Q40588|ASO_TOBAC L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE=2 SV=1 96 362 7.0E-39
sp|Q02079|LAC3_THACU Laccase-3 OS=Thanatephorus cucumeris GN=LCC3 PE=2 SV=1 96 362 2.0E-37
sp|P56193|LAC1_THACU Laccase-1 OS=Thanatephorus cucumeris GN=LCC1 PE=1 SV=1 96 362 5.0E-34
sp|Q96WM9|LAC2_BOTFU Laccase-2 OS=Botryotinia fuckeliana GN=lcc2 PE=2 SV=1 99 358 1.0E-32
sp|Q99055|LAC4_TRAVI Laccase-4 OS=Trametes villosa GN=LCC4 PE=3 SV=1 99 358 7.0E-32
sp|Q12542|LAC2_AGABI Laccase-2 OS=Agaricus bisporus GN=lcc2 PE=1 SV=1 96 358 8.0E-32
sp|Q02075|LAC2_THACU Laccase-2 OS=Thanatephorus cucumeris GN=LCC2 PE=2 SV=1 93 358 1.0E-31
sp|Q12719|LAC4_TRAVE Laccase-4 OS=Trametes versicolor GN=LCC4 PE=3 SV=1 99 358 3.0E-31
sp|Q99056|LAC5_TRAVI Laccase-5 OS=Trametes villosa GN=LCC5 PE=3 SV=2 99 332 3.0E-30
sp|Q01679|LAC1_PHLRA Laccase OS=Phlebia radiata GN=LAC PE=1 SV=2 97 358 2.0E-29
sp|Q12717|LAC5_TRAVE Laccase-5 OS=Trametes versicolor GN=LCC5 PE=2 SV=1 99 332 3.0E-29
sp|Q12541|LAC1_AGABI Laccase-1 OS=Agaricus bisporus GN=lcc1 PE=1 SV=1 96 357 3.0E-29
sp|Q12570|LAC1_BOTFU Laccase-1 OS=Botryotinia fuckeliana GN=lcc1 PE=2 SV=3 98 358 1.0E-28
sp|Q02081|LAC4_THACU Laccase-4 OS=Thanatephorus cucumeris GN=LCC4 PE=1 SV=1 106 358 1.0E-28
sp|Q9LYQ2|LAC13_ARATH Laccase-13 OS=Arabidopsis thaliana GN=LAC13 PE=2 SV=1 117 373 1.0E-27
sp|Q9FY79|LAC14_ARATH Laccase-14 OS=Arabidopsis thaliana GN=LAC14 PE=2 SV=1 114 357 5.0E-27
sp|Q8VZA1|LAC11_ARATH Laccase-11 OS=Arabidopsis thaliana GN=LAC11 PE=2 SV=1 112 358 5.0E-27
sp|Q9SU40|SKU5_ARATH Monocopper oxidase-like protein SKU5 OS=Arabidopsis thaliana GN=SKU5 PE=1 SV=1 95 342 6.0E-27
sp|D0VWU3|LAC1_TRAMX Laccase OS=Trametes maxima PE=1 SV=1 99 333 3.0E-26
sp|Q56YT0|LAC3_ARATH Laccase-3 OS=Arabidopsis thaliana GN=LAC3 PE=2 SV=2 117 357 4.0E-26
sp|Q2QZ80|LAC21_ORYSJ Laccase-21 OS=Oryza sativa subsp. japonica GN=LAC21 PE=2 SV=1 111 358 5.0E-26
sp|Q8RYM9|LAC2_ORYSJ Laccase-2 OS=Oryza sativa subsp. japonica GN=LAC2 PE=2 SV=1 111 358 5.0E-26
sp|Q6CII3|FET3_KLULA Iron transport multicopper oxidase FET3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FET3 PE=3 SV=1 96 375 5.0E-26
sp|Q9FLB5|LAC12_ARATH Laccase-12 OS=Arabidopsis thaliana GN=LAC12 PE=2 SV=1 117 365 7.0E-26
sp|Q941X2|LAC3_ORYSJ Laccase-3 OS=Oryza sativa subsp. japonica GN=LAC3 PE=2 SV=1 114 357 2.0E-25
sp|Q84J37|LAC15_ARATH Laccase-15 OS=Arabidopsis thaliana GN=TT10 PE=1 SV=1 112 357 5.0E-25
sp|Q99044|LAC1_TRAVI Laccase-1 OS=Trametes villosa GN=LCC1 PE=3 SV=1 99 331 6.0E-25
sp|Q6Z8L2|LAC9_ORYSJ Putative laccase-9 OS=Oryza sativa subsp. japonica GN=LAC9 PE=3 SV=1 111 358 9.0E-25
sp|Q02497|LAC1_TRAHI Laccase OS=Trametes hirsuta PE=1 SV=1 99 331 1.0E-24
sp|O81081|LAC2_ARATH Laccase-2 OS=Arabidopsis thaliana GN=LAC2 PE=2 SV=1 112 358 2.0E-24
sp|Q9FHN6|SKS2_ARATH Monocopper oxidase-like protein SKS2 OS=Arabidopsis thaliana GN=SKS2 PE=1 SV=1 96 332 2.0E-24
sp|Q5N9X2|LAC4_ORYSJ Laccase-4 OS=Oryza sativa subsp. japonica GN=LAC4 PE=2 SV=1 112 374 2.0E-24
sp|Q9SIY8|LAC5_ARATH Laccase-5 OS=Arabidopsis thaliana GN=LAC5 PE=2 SV=1 117 357 4.0E-24
sp|Q99049|LAC3_TRAVI Laccase-3 OS=Trametes villosa GN=LCC3 PE=3 SV=1 100 338 5.0E-24
sp|Q0DHL5|LAC11_ORYSJ Putative laccase-11 OS=Oryza sativa subsp. japonica GN=LAC11 PE=5 SV=2 110 357 1.0E-23
sp|Q0JHP8|LAC8_ORYSJ Laccase-8 OS=Oryza sativa subsp. japonica GN=LAC8 PE=3 SV=2 110 365 1.0E-23
sp|P78591|FET3_CANAX Iron transport multicopper oxidase FET3 OS=Candida albicans GN=FET3 PE=3 SV=1 107 338 2.0E-23
sp|Q0IQU1|LAC22_ORYSJ Laccase-22 OS=Oryza sativa subsp. japonica GN=LAC22 PE=2 SV=2 112 358 2.0E-23
sp|Q9FJD5|LAC17_ARATH Laccase-17 OS=Arabidopsis thaliana GN=LAC17 PE=2 SV=1 112 358 3.0E-23
sp|Q2QYS3|LAC23_ORYSJ Laccase-23 OS=Oryza sativa subsp. japonica GN=LAC23 PE=3 SV=1 111 359 4.0E-23
sp|P38993|FET3_YEAST Iron transport multicopper oxidase FET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET3 PE=1 SV=2 96 268 5.0E-23
sp|P78722|LAC2_PODAS Laccase-2 OS=Podospora anserina GN=LAC2 PE=2 SV=1 106 331 5.0E-23
sp|Q12739|LAC2_PLEOS Laccase-2 OS=Pleurotus ostreatus GN=POX2 PE=1 SV=1 122 358 6.0E-23
sp|O59896|LAC1_PYCCI Laccase OS=Pycnoporus cinnabarinus GN=LCC3-1 PE=1 SV=1 99 331 6.0E-23
sp|Q2RBK2|LAC17_ORYSJ Putative laccase-17 OS=Oryza sativa subsp. japonica GN=LAC17 PE=3 SV=1 114 359 9.0E-23
sp|Q0IP28|LAC25_ORYSJ Laccase-25 OS=Oryza sativa subsp. japonica GN=LAC25 PE=3 SV=1 97 357 1.0E-22
sp|Q96WT3|FET3_CANGA Iron transport multicopper oxidase FET3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FET3 PE=3 SV=1 96 268 1.0E-22
sp|O80434|LAC4_ARATH Laccase-4 OS=Arabidopsis thaliana GN=IRX12 PE=2 SV=2 111 357 2.0E-22
sp|Q99046|LAC2_TRAVI Laccase-2 OS=Trametes villosa GN=LCC2 PE=3 SV=1 106 332 2.0E-22
sp|Q9SR40|LAC7_ARATH Laccase-7 OS=Arabidopsis thaliana GN=LAC7 PE=2 SV=1 112 357 2.0E-22
sp|Q5N7B4|LAC7_ORYSJ Laccase-7 OS=Oryza sativa subsp. japonica GN=LAC7 PE=2 SV=1 114 357 3.0E-22
sp|Q9ZPY2|LAC6_ARATH Laccase-6 OS=Arabidopsis thaliana GN=LAC6 PE=2 SV=1 114 357 3.0E-22
sp|Q0DHL2|LAC12_ORYSJ Laccase-12/13 OS=Oryza sativa subsp. japonica GN=LAC12 PE=2 SV=1 112 357 4.0E-22
sp|Q03966|LAC1_CRYPA Laccase OS=Cryphonectria parasitica GN=LAC-1 PE=3 SV=1 96 357 6.0E-22
sp|D4APX3|LAC1_ARTBC Laccase ARB_05828 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05828 PE=1 SV=1 116 331 6.0E-22
sp|Q2QUN2|LAC24_ORYSJ Laccase-24 OS=Oryza sativa subsp. japonica GN=LAC24 PE=2 SV=1 111 357 1.0E-21
sp|Q12718|LAC2_TRAVE Laccase-2 OS=Trametes versicolor GN=LCC2 PE=1 SV=1 106 332 1.0E-21
sp|P43561|FET5_YEAST Iron transport multicopper oxidase FET5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET5 PE=1 SV=1 96 362 1.0E-21
sp|Q5ZCW1|LAC1_ORYSJ Putative laccase-1 OS=Oryza sativa subsp. japonica GN=LAC1 PE=3 SV=1 111 358 1.0E-21
sp|P06811|LAC1_NEUCR Laccase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lacc PE=1 SV=3 65 357 3.0E-21
sp|Q9LFD1|LAC9_ARATH Laccase-9 OS=Arabidopsis thaliana GN=LAC9 PE=2 SV=1 111 357 5.0E-21
sp|Q10ND7|LAC10_ORYSJ Laccase-10 OS=Oryza sativa subsp. japonica GN=LAC10 PE=2 SV=1 112 358 6.0E-21
sp|P29162|ASOL_TOBAC L-ascorbate oxidase homolog OS=Nicotiana tabacum PE=2 SV=1 94 338 7.0E-21
sp|Q9LFD2|LAC8_ARATH Laccase-8 OS=Arabidopsis thaliana GN=LAC8 PE=2 SV=1 111 357 1.0E-20
sp|Q5N9W4|LAC5_ORYSJ Putative laccase-5 OS=Oryza sativa subsp. japonica GN=LAC5 PE=3 SV=1 110 357 1.0E-20
sp|Q12729|LAC1_PLEOS Laccase-1 OS=Pleurotus ostreatus GN=POX1 PE=2 SV=1 123 336 1.0E-20
sp|Q00624|ASOL_BRANA L-ascorbate oxidase homolog OS=Brassica napus GN=Bp10 PE=2 SV=1 98 338 2.0E-20
sp|Q53LU4|LAC18_ORYSJ Laccase-18 OS=Oryza sativa subsp. japonica GN=LAC18 PE=2 SV=1 114 361 3.0E-20
sp|Q5N7A3|LAC6_ORYSJ Laccase-6 OS=Oryza sativa subsp. japonica GN=LAC6 PE=2 SV=1 114 357 4.0E-20
sp|A2XCN6|LAC18_ORYSI Putative laccase-18 OS=Oryza sativa subsp. indica GN=LAC18 PE=3 SV=1 114 357 5.0E-20
sp|A2Y9C5|LAC19_ORYSI Putative laccase-19 OS=Oryza sativa subsp. indica GN=LAC19 PE=3 SV=1 114 357 8.0E-20
sp|Q2R0L2|LAC19_ORYSJ Laccase-19 OS=Oryza sativa subsp. japonica GN=LAC19 PE=2 SV=1 114 357 8.0E-20
sp|Q1PDH6|LAC16_ARATH Laccase-16 OS=Arabidopsis thaliana GN=LAC16 PE=2 SV=2 111 357 3.0E-19
sp|A2Y9C2|LAC20_ORYSI Laccase-20 OS=Oryza sativa subsp. indica GN=LAC20 PE=3 SV=1 114 357 4.0E-19
sp|Q8VXX5|SKS1_ARATH Monocopper oxidase-like protein SKS1 OS=Arabidopsis thaliana GN=SKS1 PE=1 SV=1 96 332 4.0E-19
sp|Q70KY3|LAC1_MELAO Laccase-1 OS=Melanocarpus albomyces GN=LAC1 PE=1 SV=1 95 331 5.0E-19
sp|Q2R0L0|LAC20_ORYSJ Laccase-20 OS=Oryza sativa subsp. japonica GN=LAC20 PE=2 SV=1 114 357 5.0E-19
sp|Q9LMS3|LAC1_ARATH Laccase-1 OS=Arabidopsis thaliana GN=LAC1 PE=2 SV=1 112 358 5.0E-19
sp|Q69L99|LAC14_ORYSJ Laccase-14 OS=Oryza sativa subsp. japonica GN=LAC14 PE=3 SV=1 109 357 7.0E-19
sp|Q09920|FIO1_SCHPO Iron transport multicopper oxidase fio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fio1 PE=3 SV=1 95 375 8.0E-19
sp|Q96UM2|LAC3_BOTFU Laccase-3 (Fragment) OS=Botryotinia fuckeliana GN=lcc3 PE=3 SV=1 122 358 3.0E-18
sp|Q6ID18|LAC10_ARATH Laccase-10 OS=Arabidopsis thaliana GN=LAC10 PE=2 SV=1 112 357 1.0E-17
sp|Q339K6|LAC15_ORYSJ Laccase-15 OS=Oryza sativa subsp. japonica GN=LAC15 PE=2 SV=1 111 357 4.0E-16
sp|Q47452|PCOA_ECOLX Copper resistance protein A OS=Escherichia coli GN=pcoA PE=3 SV=1 96 332 2.0E-15
sp|P17489|LAC1_EMENI Laccase-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yA PE=2 SV=3 109 274 4.0E-15
sp|Q04399|GMC1_YEAST Putative multicopper oxidase GMC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GMC1 PE=1 SV=1 123 358 2.0E-12
sp|P59571|COPA_PSESM Copper resistance protein A homolog OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=copA PE=3 SV=1 96 332 4.0E-12
sp|P12374|COPA_PSEUB Copper resistance protein A OS=Pseudomonas syringae pv. tomato GN=copA PE=1 SV=1 109 332 1.0E-11
sp|Q6GIX3|MCO_STAAR Multicopper oxidase mco OS=Staphylococcus aureus (strain MRSA252) GN=mco PE=3 SV=2 123 376 2.0E-10
sp|Q69HT9|MCO_STAAU Multicopper oxidase mco OS=Staphylococcus aureus GN=mco PE=1 SV=2 123 376 3.0E-10
sp|I6WZK7|MMCO_MYCTU Multicopper oxidase MmcO OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmcO PE=1 SV=1 110 357 7.0E-10
sp|Q8CQF6|MCO_STAES Multicopper oxidase mco OS=Staphylococcus epidermidis (strain ATCC 12228) GN=mco PE=3 SV=2 123 357 1.0E-09
sp|Q4LAB0|MCO_STAHJ Multicopper oxidase mco OS=Staphylococcus haemolyticus (strain JCSC1435) GN=mco PE=3 SV=2 123 357 1.0E-09
sp|Q7XE50|LAC16_ORYSJ Putative laccase-16 OS=Oryza sativa subsp. japonica GN=LAC16 PE=5 SV=1 150 358 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005507 copper ion binding Yes
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.13 0.0 0.42
CcL In ants, during behavior modification 0.69 0.0 1.64
CcD In ants, recently dead 0.27 0.0 0.78

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 1.0 no
SC16a CcD 1.0 no
CcL CcD 1.0 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4795
MADAEPAQDVGLLLADADTTAAEDRSRRSRSVLACVWKWTALALLALATLLSLPLLAYTRRQRLPGVLVSEDGER
QLAVMLHPERHNRRRPTVLLFNWTVTQGLRAPDGVEKMVYLVNDLFPGPTLEARSGDRIVVDVVNGLSSEGIALH
WHGLRMERHNVMDGAVGFTQCAVKPGQSFVYDFTIGHDEHGTFWWHGHGQMQRGDGLFGGLVVHPPAVDWDDDDD
DDDEALLLVGDWFHRSQTHVLSWYAQDGSLGNEPVPDSLLINGRGRFDCSKAVPARPVVCESPKLDPVFAHRSET
GRTRVRVVNTGSVAGLSLAVDGASLQTVAVDGACAVRHGPESSVGVLYPGERVDVLLKWTDERRRLPRVHVYLDD
E
Coding >Ophio5|4795
ATGGCAGATGCCGAGCCCGCCCAAGACGTCGGCCTCCTCCTCGCCGACGCCGACACAACAGCAGCCGAGGACCGA
AGCAGACGTTCGAGGTCCGTCTTGGCTTGCGTGTGGAAATGGACGGCCCTGGCTTTGCTGGCGCTGGCGACGCTG
CTTTCTCTGCCGCTGCTCGCTTACACCCGTCGTCAGCGGCTGCCTGGTGTGCTTGTCTCGGAGGATGGAGAGAGA
CAGCTTGCTGTGATGCTGCATCCGGAAAGGCATAACCGTCGCCGGCCTACCGTCTTACTCTTTAACTGGACCGTC
ACTCAGGGCTTGAGGGCGCCGGATGGCGTGGAGAAGATGGTGTATCTGGTCAACGACCTCTTCCCGGGCCCAACG
CTGGAGGCTCGTTCAGGAGACCGCATCGTCGTCGACGTCGTCAACGGCCTTTCGTCAGAGGGGATTGCCCTTCAC
TGGCACGGTTTACGGATGGAGCGTCACAACGTCATGGACGGAGCTGTGGGCTTCACGCAGTGTGCCGTCAAGCCT
GGCCAGAGCTTCGTCTACGACTTCACCATCGGTCATGACGAGCACGGTACCTTTTGGTGGCATGGTCACGGCCAG
ATGCAGCGGGGAGATGGTCTGTTCGGAGGCTTGGTCGTTCATCCGCCGGCTGTTGACTGGGACGACGACGACGAC
GACGACGACGAAGCGCTTCTGCTCGTCGGCGACTGGTTTCATCGCTCGCAGACGCATGTGCTGAGTTGGTATGCA
CAGGACGGCAGCCTTGGAAACGAACCCGTTCCGGACTCGCTACTCATCAACGGCCGGGGCCGCTTCGATTGCTCC
AAGGCTGTCCCGGCTCGACCGGTCGTCTGCGAGAGTCCGAAGCTGGATCCCGTCTTTGCCCACAGGTCCGAGACA
GGCCGGACGAGAGTCAGAGTCGTCAACACCGGCTCCGTGGCGGGACTCAGTCTCGCCGTGGACGGGGCCTCGCTG
CAGACCGTGGCCGTGGATGGAGCGTGCGCCGTGCGTCATGGACCCGAAAGCTCCGTTGGTGTCTTGTATCCTGGC
GAGAGGGTCGATGTGCTCCTGAAGTGGACGGATGAGAGACGTCGTCTGCCGCGTGTCCATGTCTACCTCGACGAT
GAG
Transcript >Ophio5|4795
ATGGCAGATGCCGAGCCCGCCCAAGACGTCGGCCTCCTCCTCGCCGACGCCGACACAACAGCAGCCGAGGACCGA
AGCAGACGTTCGAGGTCCGTCTTGGCTTGCGTGTGGAAATGGACGGCCCTGGCTTTGCTGGCGCTGGCGACGCTG
CTTTCTCTGCCGCTGCTCGCTTACACCCGTCGTCAGCGGCTGCCTGGTGTGCTTGTCTCGGAGGATGGAGAGAGA
CAGCTTGCTGTGATGCTGCATCCGGAAAGGCATAACCGTCGCCGGCCTACCGTCTTACTCTTTAACTGGACCGTC
ACTCAGGGCTTGAGGGCGCCGGATGGCGTGGAGAAGATGGTGTATCTGGTCAACGACCTCTTCCCGGGCCCAACG
CTGGAGGCTCGTTCAGGAGACCGCATCGTCGTCGACGTCGTCAACGGCCTTTCGTCAGAGGGGATTGCCCTTCAC
TGGCACGGTTTACGGATGGAGCGTCACAACGTCATGGACGGAGCTGTGGGCTTCACGCAGTGTGCCGTCAAGCCT
GGCCAGAGCTTCGTCTACGACTTCACCATCGGTCATGACGAGCACGGTACCTTTTGGTGGCATGGTCACGGCCAG
ATGCAGCGGGGAGATGGTCTGTTCGGAGGCTTGGTCGTTCATCCGCCGGCTGTTGACTGGGACGACGACGACGAC
GACGACGACGAAGCGCTTCTGCTCGTCGGCGACTGGTTTCATCGCTCGCAGACGCATGTGCTGAGTTGGTATGCA
CAGGACGGCAGCCTTGGAAACGAACCCGTTCCGGACTCGCTACTCATCAACGGCCGGGGCCGCTTCGATTGCTCC
AAGGCTGTCCCGGCTCGACCGGTCGTCTGCGAGAGTCCGAAGCTGGATCCCGTCTTTGCCCACAGGTCCGAGACA
GGCCGGACGAGAGTCAGAGTCGTCAACACCGGCTCCGTGGCGGGACTCAGTCTCGCCGTGGACGGGGCCTCGCTG
CAGACCGTGGCCGTGGATGGAGCGTGCGCCGTGCGTCATGGACCCGAAAGCTCCGTTGGTGTCTTGTATCCTGGC
GAGAGGGTCGATGTGCTCCTGAAGTGGACGGATGAGAGACGTCGTCTGCCGCGTGTCCATGTCTACCTCGACGAT
GAGTGA
Gene >Ophio5|4795
ATGGCAGATGCCGAGCCCGCCCAAGACGTCGGCCTCCTCCTCGCCGACGCCGACACAACAGCAGCCGAGGACCGA
AGCAGACGTTCGAGGTCCGTCTTGGCTTGCGTGTGGAAATGGACGGCCCTGGCTTTGCTGGCGCTGGCGACGCTG
CTTTCTCTGCCGCTGCTCGCTTACACCCGTCGTCAGCGGCTGCCTGGTGTGCTTGTCTCGGAGGATGGAGAGAGA
CAGCTTGCTGTGATGCTGCATCCGGAAAGGCATAACCGTCGCCGGCCTACCGTCTTACTCTTTAACTGGACCGTC
ACTCAGGGCTTGAGGGCGCCGGATGGCGTGGAGAAGATGGTGTATCTGGTCAACGGTTAAAGCTCTTCCATGGCT
TCTTCGAAAGAAACTCTCGCCCCCTATTCTGACACGGTGGTTTTATATAGACCTCTTCCCGGGCCCAACGCTGGA
GGCTCGTTCAGGAGACCGCATCGTCGTCGACGTCGTCAACGGCCTTTCGTCAGAGGGGATTGCCCTTCACTGGCA
CGGTTTACGGATGGAGCGTCACAACGTCATGGACGGAGCTGTGGGCTTCACGCAGTGTGCCGTCAAGCCTGGCCA
GAGCTTCGTCTACGACTTCACCATCGGTCATGACGAGCACGGTACCTTTTGGTGGCATGGTCACGGCCAGATGCA
GCGGGGAGATGGTCTGTTCGGAGGCTTGGTCGTTCATCCGCCGGCTGTTGACTGGGACGACGACGACGACGACGA
CGACGAAGCGCTTCTGCTCGTCGGCGACTGGTTTCATCGCTCGCAGACGCATGTGCTGAGTTGGTATGCACAGGA
CGGCAGCCTTGGAAACGAACCCGTTCCGGACTCGCTACTCATCAACGGCCGGGGCCGCTTCGATTGCTCCAAGGC
TGTCCCGGCTCGACCGGTCGTCTGCGAGAGTCCGAAGCTGGATCCCGTCTTTGCCCACAGGTCCGAGACAGGCCG
GACGAGAGTCAGAGTCGTCAACACCGGCTCCGTGGCGGGACTCAGTCTCGCCGTGGACGGGGCCTCGCTGCAGAC
CGTGGCCGTGGATGGAGCGTGCGCCGTGCGTCATGGACCCGAAAGCTCCGTTGGTGTCTTGTATCCTGGCGAGAG
GGTCGATGTGCTCCTGAAGTGGACGGATGAGAGACGTCGTCTGCCGCGTGTCCATGTCTACCTCGACGATGAGTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail