Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4794
Gene name
Locationscaffold_383:12991..14997
Strand-
Gene length (bp)2006
Transcript length (bp)1872
Coding sequence length (bp)1869
Protein length (aa) 623

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04185 Phosphoesterase Phosphoesterase family 5.9E-77 28 400

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P15713|PHLN_PSEAE Non-hemolytic phospholipase C OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=plcN PE=3 SV=2 25 442 6.0E-67
sp|P9WIB1|PHLC_MYCTU Phospholipase C 3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=plcC PE=1 SV=1 16 463 3.0E-64
sp|P9WIB0|PHLC_MYCTO Phospholipase C 3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=plcC PE=3 SV=1 16 463 3.0E-64
sp|Q9RGS8|PHLN_BURPS Non-hemolytic phospholipase C OS=Burkholderia pseudomallei (strain K96243) GN=plcN PE=1 SV=2 4 442 4.0E-64
sp|P06200|PHLC_PSEAE Hemolytic phospholipase C OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=plcH PE=3 SV=2 25 446 6.0E-61
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P15713|PHLN_PSEAE Non-hemolytic phospholipase C OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=plcN PE=3 SV=2 25 442 6.0E-67
sp|P9WIB1|PHLC_MYCTU Phospholipase C 3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=plcC PE=1 SV=1 16 463 3.0E-64
sp|P9WIB0|PHLC_MYCTO Phospholipase C 3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=plcC PE=3 SV=1 16 463 3.0E-64
sp|Q9RGS8|PHLN_BURPS Non-hemolytic phospholipase C OS=Burkholderia pseudomallei (strain K96243) GN=plcN PE=1 SV=2 4 442 4.0E-64
sp|P06200|PHLC_PSEAE Hemolytic phospholipase C OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=plcH PE=3 SV=2 25 446 6.0E-61
sp|P9WIA9|PHLD_MYCTU Phospholipase C 4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=plcD PE=3 SV=1 3 434 2.0E-55
sp|P9WIA8|PHLD_MYCTO Phospholipase C 4 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=plcD PE=3 SV=1 3 434 2.0E-55
sp|P0A5R9|PHLD_MYCBO Phospholipase C 4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=plcD PE=3 SV=1 3 434 2.0E-55
sp|P9WIB4|PHLA_MYCTO Phospholipase C 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=plcA PE=3 SV=1 16 475 9.0E-52
sp|P9WIB5|PHLA_MYCTU Phospholipase C 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=plcA PE=1 SV=1 16 475 9.0E-52
sp|P9WIB3|PHLB_MYCTU Phospholipase C 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=plcB PE=1 SV=1 4 453 3.0E-49
sp|P9WIB2|PHLB_MYCTO Phospholipase C 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=plcB PE=3 SV=1 4 453 3.0E-49
sp|Q8H965|NPC6_ARATH Non-specific phospholipase C6 OS=Arabidopsis thaliana GN=NPC6 PE=2 SV=1 3 387 1.0E-13
sp|Q9SRQ6|NPC3_ARATH Non-specific phospholipase C3 OS=Arabidopsis thaliana GN=NPC3 PE=2 SV=1 28 444 2.0E-13
sp|O81020|NPC2_ARATH Non-specific phospholipase C2 OS=Arabidopsis thaliana GN=NPC2 PE=2 SV=1 7 384 3.0E-13
sp|Q9S816|NPC5_ARATH Non-specific phospholipase C5 OS=Arabidopsis thaliana GN=NPC5 PE=2 SV=1 28 384 2.0E-12
sp|Q9SRQ7|NPC4_ARATH Non-specific phospholipase C4 OS=Arabidopsis thaliana GN=NPC4 PE=1 SV=1 23 384 6.0E-12
sp|Q8L7Y9|NPC1_ARATH Non-specific phospholipase C1 OS=Arabidopsis thaliana GN=NPC1 PE=2 SV=1 28 387 8.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4794
MALLGLYALLVSAAHGLCSAHVAGLAEIDHVVLFMQENRAFDHYFGTMAGVRGFNDANLQINNGVPVWKQRTSPG
LTNETHFVTPWYLNYLGGNWSEATQCIISGSNGWYENHAAWNNGFNDHWALNNTPWSIGFYKRHDVPTQWALADG
WVIADMYQESVVASTSPNRVTWISGSINVPGSPQKPDQGGNPYIDNNETPGCERGGINCYPLKWKTAAEHYEEAG
VSWQVYQDADNFDDNPFAWFKQFQDAKKGSSLHSRGVKGLSLDTFYHQAANGSLPDISYIVGPTELSEHAPYSPH
DGAWLQNKIAEAVIQSPKYAKTVLIVSFDESGGWFDHVDPFRAPDGTPAEWLDDPYGQVGHTFAGPGFRVPLYVI
SPWTRHGGVYTEHSDHNSQLLFIERWQASKGRNVTTSEMVPWRRENMGDLVAAFDFQNPDYTLPDLPPAPEPHKD
HKRGIYDGSAHCLGLYDKTRPPVPYTGEGARENMASLVEAGFKPMRGRLTEGRFLVLVMNSYALSSAPHTKTAFL
SRSTERHEAPEQRWVAHAVKQGGHEFTLSSAVDGRFLSADADLCAEPGEALKLVVDFRPSEGYGFRLQHSGLYLA
ASEDGILCFVEDGRYWTLYAVNY
Coding >Ophio5|4794
ATGGCTCTCCTCGGGCTCTACGCCCTGCTGGTCTCGGCCGCGCATGGCCTTTGCTCAGCCCATGTCGCCGGTCTG
GCGGAAATTGATCATGTCGTGCTGTTCATGCAAGAGAACCGGGCATTTGATCATTACTTTGGTACCATGGCCGGC
GTTCGTGGCTTCAACGACGCCAACCTGCAAATCAACAACGGCGTCCCGGTCTGGAAGCAGCGTACCAGTCCCGGA
CTGACAAACGAGACGCACTTCGTCACCCCCTGGTATCTCAATTATCTCGGCGGCAACTGGTCCGAAGCCACGCAG
TGCATCATCTCCGGGAGTAACGGGTGGTATGAGAACCACGCTGCGTGGAACAATGGCTTCAACGATCACTGGGCC
CTGAACAATACGCCCTGGAGCATCGGCTTCTACAAGCGGCACGATGTACCCACTCAATGGGCGCTGGCGGACGGC
TGGGTGATTGCAGACATGTATCAAGAATCGGTCGTGGCGTCTACCTCGCCAAACCGGGTCACCTGGATATCTGGA
TCCATCAACGTGCCCGGCAGCCCCCAGAAGCCCGATCAGGGAGGCAACCCCTACATCGATAACAATGAGACCCCT
GGCTGCGAGAGAGGGGGCATCAACTGCTACCCCTTAAAGTGGAAAACGGCGGCCGAGCACTACGAAGAAGCCGGC
GTCTCCTGGCAAGTATACCAAGACGCTGACAACTTTGATGACAACCCCTTTGCTTGGTTCAAACAGTTTCAGGAC
GCCAAGAAGGGATCGAGTCTTCATAGTAGAGGCGTCAAGGGCCTTTCGCTCGACACCTTCTACCACCAGGCCGCC
AACGGAAGCCTACCCGACATCTCGTACATCGTCGGCCCCACGGAGCTATCCGAGCACGCGCCCTATTCTCCGCAC
GACGGGGCGTGGCTGCAGAACAAGATAGCCGAGGCCGTCATCCAGTCGCCCAAATACGCCAAAACGGTCCTCATC
GTCTCCTTTGACGAATCGGGCGGTTGGTTCGACCATGTGGACCCCTTCCGCGCGCCGGACGGGACACCGGCCGAG
TGGCTTGATGACCCGTACGGCCAGGTCGGTCACACCTTTGCCGGGCCGGGATTCCGAGTGCCCCTATATGTGATT
TCGCCGTGGACTCGACACGGCGGCGTCTACACGGAGCATTCGGACCATAACTCGCAATTGCTCTTCATCGAGAGG
TGGCAGGCTTCCAAGGGTCGCAATGTCACCACCAGCGAGATGGTGCCGTGGCGGAGAGAGAATATGGGTGACCTT
GTCGCTGCTTTCGACTTTCAGAACCCGGATTATACTCTCCCTGACTTGCCACCGGCACCGGAGCCGCACAAGGAC
CACAAGAGGGGGATCTACGACGGGTCTGCACACTGCTTGGGCCTTTATGACAAAACGCGGCCGCCTGTCCCGTAC
ACAGGCGAAGGGGCTCGCGAGAACATGGCGTCTCTGGTGGAAGCAGGGTTCAAGCCTATGCGCGGACGTCTCACC
GAGGGACGTTTTCTCGTCCTGGTCATGAATTCCTACGCCCTGTCTTCTGCTCCGCACACCAAGACCGCCTTCCTA
AGCAGGAGCACCGAAAGACACGAAGCACCAGAGCAGCGATGGGTAGCTCACGCGGTAAAGCAGGGCGGCCATGAG
TTCACCCTCAGCAGCGCCGTCGACGGCCGCTTCTTGTCCGCGGACGCCGACCTGTGCGCCGAGCCAGGCGAAGCG
CTGAAGTTGGTGGTGGACTTTCGGCCGAGTGAGGGCTACGGCTTCCGGCTTCAGCATTCCGGTTTGTACTTGGCT
GCTTCTGAAGATGGGATCTTGTGCTTTGTCGAGGATGGGAGGTATTGGACCTTGTATGCCGTGAACTAC
Transcript >Ophio5|4794
ATGGCTCTCCTCGGGCTCTACGCCCTGCTGGTCTCGGCCGCGCATGGCCTTTGCTCAGCCCATGTCGCCGGTCTG
GCGGAAATTGATCATGTCGTGCTGTTCATGCAAGAGAACCGGGCATTTGATCATTACTTTGGTACCATGGCCGGC
GTTCGTGGCTTCAACGACGCCAACCTGCAAATCAACAACGGCGTCCCGGTCTGGAAGCAGCGTACCAGTCCCGGA
CTGACAAACGAGACGCACTTCGTCACCCCCTGGTATCTCAATTATCTCGGCGGCAACTGGTCCGAAGCCACGCAG
TGCATCATCTCCGGGAGTAACGGGTGGTATGAGAACCACGCTGCGTGGAACAATGGCTTCAACGATCACTGGGCC
CTGAACAATACGCCCTGGAGCATCGGCTTCTACAAGCGGCACGATGTACCCACTCAATGGGCGCTGGCGGACGGC
TGGGTGATTGCAGACATGTATCAAGAATCGGTCGTGGCGTCTACCTCGCCAAACCGGGTCACCTGGATATCTGGA
TCCATCAACGTGCCCGGCAGCCCCCAGAAGCCCGATCAGGGAGGCAACCCCTACATCGATAACAATGAGACCCCT
GGCTGCGAGAGAGGGGGCATCAACTGCTACCCCTTAAAGTGGAAAACGGCGGCCGAGCACTACGAAGAAGCCGGC
GTCTCCTGGCAAGTATACCAAGACGCTGACAACTTTGATGACAACCCCTTTGCTTGGTTCAAACAGTTTCAGGAC
GCCAAGAAGGGATCGAGTCTTCATAGTAGAGGCGTCAAGGGCCTTTCGCTCGACACCTTCTACCACCAGGCCGCC
AACGGAAGCCTACCCGACATCTCGTACATCGTCGGCCCCACGGAGCTATCCGAGCACGCGCCCTATTCTCCGCAC
GACGGGGCGTGGCTGCAGAACAAGATAGCCGAGGCCGTCATCCAGTCGCCCAAATACGCCAAAACGGTCCTCATC
GTCTCCTTTGACGAATCGGGCGGTTGGTTCGACCATGTGGACCCCTTCCGCGCGCCGGACGGGACACCGGCCGAG
TGGCTTGATGACCCGTACGGCCAGGTCGGTCACACCTTTGCCGGGCCGGGATTCCGAGTGCCCCTATATGTGATT
TCGCCGTGGACTCGACACGGCGGCGTCTACACGGAGCATTCGGACCATAACTCGCAATTGCTCTTCATCGAGAGG
TGGCAGGCTTCCAAGGGTCGCAATGTCACCACCAGCGAGATGGTGCCGTGGCGGAGAGAGAATATGGGTGACCTT
GTCGCTGCTTTCGACTTTCAGAACCCGGATTATACTCTCCCTGACTTGCCACCGGCACCGGAGCCGCACAAGGAC
CACAAGAGGGGGATCTACGACGGGTCTGCACACTGCTTGGGCCTTTATGACAAAACGCGGCCGCCTGTCCCGTAC
ACAGGCGAAGGGGCTCGCGAGAACATGGCGTCTCTGGTGGAAGCAGGGTTCAAGCCTATGCGCGGACGTCTCACC
GAGGGACGTTTTCTCGTCCTGGTCATGAATTCCTACGCCCTGTCTTCTGCTCCGCACACCAAGACCGCCTTCCTA
AGCAGGAGCACCGAAAGACACGAAGCACCAGAGCAGCGATGGGTAGCTCACGCGGTAAAGCAGGGCGGCCATGAG
TTCACCCTCAGCAGCGCCGTCGACGGCCGCTTCTTGTCCGCGGACGCCGACCTGTGCGCCGAGCCAGGCGAAGCG
CTGAAGTTGGTGGTGGACTTTCGGCCGAGTGAGGGCTACGGCTTCCGGCTTCAGCATTCCGGTTTGTACTTGGCT
GCTTCTGAAGATGGGATCTTGTGCTTTGTCGAGGATGGGAGGTATTGGACCTTGTATGCCGTGAACTACTGA
Gene >Ophio5|4794
ATGGCTCTCCTCGGGCTCTACGCCCTGCTGGTCTCGGCCGCGCATGGCCTTTGCTCAGCCCATGTCGCCGGTCTG
GCGGAAATTGATCATGTCGTGCTGTTCATGCAAGGTGAAGTGTCAACCCGACTCGATAACCAATATAGTCGCCTT
AGCTGATAGCAACACGCATTGCAGAGAACCGGGCATTTGATCATTACTTTGGTACCATGGCCGGCGTTCGTGGCT
TCAACGACGCCAACCTGCAAATCAACAACGGCGTCCCGGTCTGGAAGCAGCGTACCAGTCCCGGACTGACAAACG
AGACGCACTTCGTCACCCCCTGGTATCTCAATTATCTCGGCGGCAACTGGTCCGAAGCCACGCAGTGCATCATCT
CCGGGAGTAACGGGTGGTATGAGAACCACGCTGCGTGGAACAATGGCTTCAACGATCACTGGGCCCTGAACAATA
CGCCCTGGAGCATCGGCTTCTACAAGCGGCACGATGTACCCACTCAATGGGCGCTGGCGGACGGCTGGGTGATTG
CAGACATGTATCAAGTACGCTCGTCTATATCATATCGGATGCTACTAGATGCCCCGTTGTTCAGCAGCTGAACTG
GTCTCCAGGAATCGGTCGTGGCGTCTACCTCGCCAAACCGGGTCACCTGGATATCTGGATCCATCAACGTGCCCG
GCAGCCCCCAGAAGCCCGATCAGGGAGGCAACCCCTACATCGATAACAATGAGACCCCTGGCTGCGAGAGAGGGG
GCATCAACTGCTACCCCTTAAAGTGGAAAACGGCGGCCGAGCACTACGAAGAAGCCGGCGTCTCCTGGCAAGTAT
ACCAAGACGCTGACAACTTTGATGACAACCCCTTTGCTTGGTTCAAACAGTTTCAGGACGCCAAGAAGGGATCGA
GTCTTCATAGTAGAGGCGTCAAGGGCCTTTCGCTCGACACCTTCTACCACCAGGCCGCCAACGGAAGCCTACCCG
ACATCTCGTACATCGTCGGCCCCACGGAGCTATCCGAGCACGCGCCCTATTCTCCGCACGACGGGGCGTGGCTGC
AGAACAAGATAGCCGAGGCCGTCATCCAGTCGCCCAAATACGCCAAAACGGTCCTCATCGTCTCCTTTGACGAAT
CGGGCGGTTGGTTCGACCATGTGGACCCCTTCCGCGCGCCGGACGGGACACCGGCCGAGTGGCTTGATGACCCGT
ACGGCCAGGTCGGTCACACCTTTGCCGGGCCGGGATTCCGAGTGCCCCTATATGTGATTTCGCCGTGGACTCGAC
ACGGCGGCGTCTACACGGAGCATTCGGACCATAACTCGCAATTGCTCTTCATCGAGAGGTGGCAGGCTTCCAAGG
GTCGCAATGTCACCACCAGCGAGATGGTGCCGTGGCGGAGAGAGAATATGGGTGACCTTGTCGCTGCTTTCGACT
TTCAGAACCCGGATTATACTCTCCCTGACTTGCCACCGGCACCGGAGCCGCACAAGGACCACAAGAGGGGGATCT
ACGACGGGTCTGCACACTGCTTGGGCCTTTATGACAAAACGCGGCCGCCTGTCCCGTACACAGGCGAAGGGGCTC
GCGAGAACATGGCGTCTCTGGTGGAAGCAGGGTTCAAGCCTATGCGCGGACGTCTCACCGAGGGACGTTTTCTCG
TCCTGGTCATGAATTCCTACGCCCTGTCTTCTGCTCCGCACACCAAGACCGCCTTCCTAAGCAGGAGCACCGAAA
GACACGAAGCACCAGAGCAGCGATGGGTAGCTCACGCGGTAAAGCAGGGCGGCCATGAGTTCACCCTCAGCAGCG
CCGTCGACGGCCGCTTCTTGTCCGCGGACGCCGACCTGTGCGCCGAGCCAGGCGAAGCGCTGAAGTTGGTGGTGG
ACTTTCGGCCGAGTGAGGGCTACGGCTTCCGGCTTCAGCATTCCGGTTTGTACTTGGCTGCTTCTGAAGATGGGA
TCTTGTGCTTTGTCGAGGATGGGAGGTATTGGACCTTGTATGCCGTGAACTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail