Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4775
Gene name
Locationscaffold_381:148..3490
Strand-
Gene length (bp)3342
Transcript length (bp)3177
Coding sequence length (bp)3174
Protein length (aa) 1058

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09794 Avl9 Transport protein Avl9 2.3E-144 31 408

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12500|AVL9_YEAST Late secretory pathway protein AVL9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVL9 PE=1 SV=1 31 479 5.0E-117
sp|O13943|AVL9_SCHPO Late secretory pathway protein avl9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avl9 PE=3 SV=2 34 466 2.0E-92
sp|Q80U56|AVL9_MOUSE Late secretory pathway protein AVL9 homolog OS=Mus musculus GN=Avl9 PE=1 SV=2 25 251 2.0E-41
sp|Q5R991|AVL9_PONAB Late secretory pathway protein AVL9 homolog OS=Pongo abelii GN=AVL9 PE=2 SV=1 31 272 3.0E-41
sp|Q8NBF6|AVL9_HUMAN Late secretory pathway protein AVL9 homolog OS=Homo sapiens GN=AVL9 PE=1 SV=1 31 272 4.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12500|AVL9_YEAST Late secretory pathway protein AVL9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AVL9 PE=1 SV=1 31 479 5.0E-117
sp|O13943|AVL9_SCHPO Late secretory pathway protein avl9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=avl9 PE=3 SV=2 34 466 2.0E-92
sp|Q80U56|AVL9_MOUSE Late secretory pathway protein AVL9 homolog OS=Mus musculus GN=Avl9 PE=1 SV=2 25 251 2.0E-41
sp|Q5R991|AVL9_PONAB Late secretory pathway protein AVL9 homolog OS=Pongo abelii GN=AVL9 PE=2 SV=1 31 272 3.0E-41
sp|Q8NBF6|AVL9_HUMAN Late secretory pathway protein AVL9 homolog OS=Homo sapiens GN=AVL9 PE=1 SV=1 31 272 4.0E-41
sp|Q80U56|AVL9_MOUSE Late secretory pathway protein AVL9 homolog OS=Mus musculus GN=Avl9 PE=1 SV=2 237 484 7.0E-24
sp|Q8NBF6|AVL9_HUMAN Late secretory pathway protein AVL9 homolog OS=Homo sapiens GN=AVL9 PE=1 SV=1 237 484 1.0E-23
sp|Q5R991|AVL9_PONAB Late secretory pathway protein AVL9 homolog OS=Pongo abelii GN=AVL9 PE=2 SV=1 237 476 2.0E-18
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4775
MSGGDDSSSLDGARQLSISSSSTPSPFSPLVTVVGFHHARGPEVETWFGVDDGADPSIDFAWPLLPFMALSDGAH
ASEEDFSYFTLLRPATDSEPATSLFGISCTRQLDASQLLKRPADVTRSTVQKAVVVIADTPQFFGMLRERLSIVT
QAWFAQRDFTDVEILRRFQESLADEKARGTLAIDATRDQYLGMSLRELIHEFRWQTLVLFKCCLLQPKMLFFGSR
CDRLCMVQFSLISLIPGLLRSLQDCADPDLDSYEKKLSRPTSLQSSNRSSLLSFMGLPLQIFGKGGFFGPYTPLQ
QLDILADFGTKSYLVGSTNSLLLQQRDRYSDILINLDEDTVTITSTSLRSALALTAADRRWIDFLTQEVNETWDE
TNPSRPKTMQYIGSEEFIRSQFESYILGLISSVKYHNFLASNADGTKGAEDPAVDFGLEWVEAWERTENYRMWNT
HTDANLFAVSEPKHPCAGGLTIDDVQRRLSEQVKELHLDERFAQGREILGRNLAVGREKASTMLNRLYADVEYLR
ESQLRRSDEAKPEGSKSPPEKSQAQYSVDLAKAQQTMQSVGVKAGAYMSSWATWAGERRKGGGWGAAWGRKSKTA
SAPGSPENQTMSPGSSRTPSMDDYAKRPPTQASFCESILSAASLSQDDRRDSKSSTVDFPVDGTTAGEKELTADV
GAAGGRGSVVGIYEEKESSPTTKESTTDARDESAAVSRVSSAAAQQKDSQDEKSSARSEESAADAQEMGTFAEES
NAWREQSTAEANEDDESEESEPEPTAVAKELDTFKEESNAWREQSAADASGDEEPEASVREPKETAEDADDVSAE
EKTAEDDGWAAGEKKGAVDGRENDKSDGLQAKDTTGDAHDTLAARAETAETTPDAEGDGLSALTWKGTTAEAEDT
CSVRANGTPAAAQEGDKPAGLRPKAKEDDAETDDAPTTVKEKTTDADDETTAKEIIADTHMASNTADEEKSTEDA
SATTAKKSPAEEAATTATAKQSPEDDRVVQTSASVKDATRDPRDESFPNHVRSDLLAAQVALPDSPAPTPTRAEA
EAASPAVQ
Coding >Ophio5|4775
ATGAGCGGCGGCGACGATAGCAGCTCCCTGGACGGGGCTCGACAGCTGTCTATCTCGTCGTCGTCGACGCCCTCG
CCCTTTTCGCCTCTCGTCACCGTCGTCGGCTTCCATCATGCCCGTGGCCCCGAGGTCGAGACGTGGTTCGGCGTC
GACGATGGCGCTGATCCTTCCATTGACTTTGCCTGGCCACTGCTCCCCTTCATGGCCTTGAGCGACGGGGCACAC
GCCTCCGAAGAGGACTTTTCCTACTTTACTCTCCTGAGGCCAGCCACCGACTCGGAGCCGGCAACGTCTCTGTTT
GGCATCTCGTGTACCCGACAGCTCGACGCGTCCCAACTCCTCAAGCGCCCCGCTGATGTCACGCGCTCCACCGTC
CAAAAGGCCGTCGTCGTCATCGCCGACACCCCCCAGTTCTTCGGCATGCTGCGCGAGCGGCTGAGCATCGTCACC
CAGGCCTGGTTTGCCCAGCGCGACTTCACAGACGTCGAAATACTGCGTCGCTTCCAAGAGAGCCTCGCGGATGAG
AAAGCCAGGGGCACATTGGCCATAGACGCTACCCGGGACCAATATCTCGGCATGAGTCTCCGCGAGCTCATTCAT
GAATTCAGGTGGCAGACGCTGGTTCTCTTCAAGTGCTGTCTTCTGCAGCCCAAGATGCTCTTCTTTGGCTCCCGC
TGCGATAGGCTGTGCATGGTCCAATTCTCCCTCATCTCGCTCATCCCCGGACTCTTGCGCAGCTTGCAAGACTGC
GCAGACCCCGACTTGGACAGCTACGAGAAGAAGCTGTCGCGGCCTACCAGCCTGCAGAGCAGCAACCGAAGCTCT
CTGCTGTCTTTCATGGGGCTTCCCTTGCAAATTTTTGGCAAGGGCGGATTCTTTGGTCCCTACACGCCGCTGCAG
CAACTCGACATCTTGGCCGACTTCGGCACCAAGTCCTACCTGGTCGGCAGCACCAACTCGTTGCTTCTGCAGCAG
AGGGACCGCTATAGCGACATCCTTATCAATCTGGACGAGGACACCGTCACCATCACGTCGACGTCTTTGCGATCT
GCCCTGGCCCTGACCGCCGCCGACCGTCGATGGATAGACTTCCTCACCCAGGAGGTCAACGAGACCTGGGACGAG
ACGAACCCGAGCAGGCCCAAGACGATGCAGTACATAGGGAGCGAGGAGTTCATCAGGTCGCAGTTCGAGTCATAC
ATTCTCGGCTTGATATCCTCGGTCAAGTACCACAACTTCCTTGCCTCCAATGCCGATGGCACCAAGGGGGCCGAG
GACCCGGCTGTCGACTTTGGCCTGGAGTGGGTTGAGGCCTGGGAGCGCACGGAAAACTATCGCATGTGGAATACG
CATACCGACGCCAACCTCTTCGCCGTCTCGGAGCCCAAGCATCCTTGCGCCGGCGGCCTCACCATCGACGACGTC
CAGAGGCGCCTATCCGAACAGGTCAAGGAGCTGCATCTCGACGAGCGTTTCGCCCAGGGCCGCGAGATCCTTGGC
CGCAACTTGGCGGTTGGCCGCGAAAAGGCTTCGACGATGCTCAACAGGCTCTACGCCGACGTCGAGTATCTGCGT
GAGTCACAGCTCCGCCGTTCCGACGAGGCCAAGCCCGAGGGCTCCAAGTCGCCGCCGGAAAAGTCCCAAGCGCAG
TACTCGGTCGACCTGGCCAAGGCGCAGCAGACGATGCAGTCTGTTGGCGTCAAGGCCGGCGCCTACATGTCCAGC
TGGGCCACCTGGGCGGGCGAGCGGCGCAAAGGCGGCGGATGGGGCGCGGCTTGGGGTAGGAAGTCCAAGACTGCT
TCGGCGCCGGGGAGCCCGGAGAACCAAACGATGAGTCCCGGGTCGTCGAGGACGCCTTCGATGGATGATTATGCC
AAGAGGCCGCCGACGCAAGCGAGCTTTTGCGAGAGCATTCTCTCTGCCGCGAGCCTCTCTCAGGATGATAGGCGG
GATTCCAAGTCGTCTACCGTGGATTTCCCAGTTGACGGGACGACAGCCGGCGAGAAGGAGTTGACTGCAGATGTA
GGCGCAGCCGGTGGGAGGGGATCGGTCGTGGGCATTTATGAGGAAAAGGAATCCTCGCCCACGACGAAGGAGTCG
ACCACTGACGCACGTGACGAATCCGCGGCCGTCAGCCGAGTATCTTCCGCAGCTGCCCAGCAGAAGGATTCGCAG
GACGAGAAATCCAGTGCCAGGAGCGAGGAGTCTGCTGCAGACGCCCAGGAGATGGGCACGTTCGCGGAGGAATCC
AACGCTTGGAGGGAGCAATCGACGGCAGAAGCCAATGAAGATGACGAGTCTGAAGAATCCGAGCCGGAACCGACC
GCAGTCGCCAAAGAGCTGGATACGTTCAAGGAGGAATCCAACGCTTGGAGGGAGCAGTCGGCTGCCGACGCCTCA
GGGGATGAAGAGCCCGAGGCATCTGTGCGGGAGCCGAAGGAGACGGCCGAAGACGCAGACGACGTATCTGCCGAG
GAGAAGACGGCAGAAGACGACGGCTGGGCGGCTGGCGAAAAGAAGGGGGCCGTAGATGGCCGAGAGAATGACAAA
TCTGACGGGCTTCAGGCGAAGGACACGACGGGAGACGCACATGATACCTTGGCAGCGAGGGCAGAGACAGCGGAG
ACGACTCCTGACGCCGAGGGTGATGGACTATCTGCTCTTACTTGGAAGGGGACGACGGCCGAGGCAGAAGACACT
TGCAGCGTCAGGGCAAACGGGACGCCCGCAGCGGCCCAAGAGGGAGACAAGCCGGCAGGATTAAGGCCCAAGGCA
AAGGAGGATGACGCAGAGACAGACGACGCGCCCACGACGGTAAAGGAAAAGACGACAGACGCAGACGACGAGACG
ACGGCCAAGGAAATCATAGCAGACACGCACATGGCATCTAATACGGCGGACGAGGAGAAGTCGACGGAAGACGCA
TCCGCCACCACAGCGAAAAAGAGCCCAGCAGAGGAAGCGGCCACGACAGCCACGGCAAAACAATCGCCTGAAGAT
GACCGCGTCGTCCAAACCTCGGCCAGCGTAAAAGACGCAACCCGCGACCCCAGAGACGAATCCTTCCCCAACCAC
GTCAGGTCGGATCTGCTCGCCGCCCAGGTCGCCCTGCCCGACTCCCCCGCGCCGACGCCGACCAGGGCCGAGGCC
GAGGCTGCGTCTCCCGCGGTTCAG
Transcript >Ophio5|4775
ATGAGCGGCGGCGACGATAGCAGCTCCCTGGACGGGGCTCGACAGCTGTCTATCTCGTCGTCGTCGACGCCCTCG
CCCTTTTCGCCTCTCGTCACCGTCGTCGGCTTCCATCATGCCCGTGGCCCCGAGGTCGAGACGTGGTTCGGCGTC
GACGATGGCGCTGATCCTTCCATTGACTTTGCCTGGCCACTGCTCCCCTTCATGGCCTTGAGCGACGGGGCACAC
GCCTCCGAAGAGGACTTTTCCTACTTTACTCTCCTGAGGCCAGCCACCGACTCGGAGCCGGCAACGTCTCTGTTT
GGCATCTCGTGTACCCGACAGCTCGACGCGTCCCAACTCCTCAAGCGCCCCGCTGATGTCACGCGCTCCACCGTC
CAAAAGGCCGTCGTCGTCATCGCCGACACCCCCCAGTTCTTCGGCATGCTGCGCGAGCGGCTGAGCATCGTCACC
CAGGCCTGGTTTGCCCAGCGCGACTTCACAGACGTCGAAATACTGCGTCGCTTCCAAGAGAGCCTCGCGGATGAG
AAAGCCAGGGGCACATTGGCCATAGACGCTACCCGGGACCAATATCTCGGCATGAGTCTCCGCGAGCTCATTCAT
GAATTCAGGTGGCAGACGCTGGTTCTCTTCAAGTGCTGTCTTCTGCAGCCCAAGATGCTCTTCTTTGGCTCCCGC
TGCGATAGGCTGTGCATGGTCCAATTCTCCCTCATCTCGCTCATCCCCGGACTCTTGCGCAGCTTGCAAGACTGC
GCAGACCCCGACTTGGACAGCTACGAGAAGAAGCTGTCGCGGCCTACCAGCCTGCAGAGCAGCAACCGAAGCTCT
CTGCTGTCTTTCATGGGGCTTCCCTTGCAAATTTTTGGCAAGGGCGGATTCTTTGGTCCCTACACGCCGCTGCAG
CAACTCGACATCTTGGCCGACTTCGGCACCAAGTCCTACCTGGTCGGCAGCACCAACTCGTTGCTTCTGCAGCAG
AGGGACCGCTATAGCGACATCCTTATCAATCTGGACGAGGACACCGTCACCATCACGTCGACGTCTTTGCGATCT
GCCCTGGCCCTGACCGCCGCCGACCGTCGATGGATAGACTTCCTCACCCAGGAGGTCAACGAGACCTGGGACGAG
ACGAACCCGAGCAGGCCCAAGACGATGCAGTACATAGGGAGCGAGGAGTTCATCAGGTCGCAGTTCGAGTCATAC
ATTCTCGGCTTGATATCCTCGGTCAAGTACCACAACTTCCTTGCCTCCAATGCCGATGGCACCAAGGGGGCCGAG
GACCCGGCTGTCGACTTTGGCCTGGAGTGGGTTGAGGCCTGGGAGCGCACGGAAAACTATCGCATGTGGAATACG
CATACCGACGCCAACCTCTTCGCCGTCTCGGAGCCCAAGCATCCTTGCGCCGGCGGCCTCACCATCGACGACGTC
CAGAGGCGCCTATCCGAACAGGTCAAGGAGCTGCATCTCGACGAGCGTTTCGCCCAGGGCCGCGAGATCCTTGGC
CGCAACTTGGCGGTTGGCCGCGAAAAGGCTTCGACGATGCTCAACAGGCTCTACGCCGACGTCGAGTATCTGCGT
GAGTCACAGCTCCGCCGTTCCGACGAGGCCAAGCCCGAGGGCTCCAAGTCGCCGCCGGAAAAGTCCCAAGCGCAG
TACTCGGTCGACCTGGCCAAGGCGCAGCAGACGATGCAGTCTGTTGGCGTCAAGGCCGGCGCCTACATGTCCAGC
TGGGCCACCTGGGCGGGCGAGCGGCGCAAAGGCGGCGGATGGGGCGCGGCTTGGGGTAGGAAGTCCAAGACTGCT
TCGGCGCCGGGGAGCCCGGAGAACCAAACGATGAGTCCCGGGTCGTCGAGGACGCCTTCGATGGATGATTATGCC
AAGAGGCCGCCGACGCAAGCGAGCTTTTGCGAGAGCATTCTCTCTGCCGCGAGCCTCTCTCAGGATGATAGGCGG
GATTCCAAGTCGTCTACCGTGGATTTCCCAGTTGACGGGACGACAGCCGGCGAGAAGGAGTTGACTGCAGATGTA
GGCGCAGCCGGTGGGAGGGGATCGGTCGTGGGCATTTATGAGGAAAAGGAATCCTCGCCCACGACGAAGGAGTCG
ACCACTGACGCACGTGACGAATCCGCGGCCGTCAGCCGAGTATCTTCCGCAGCTGCCCAGCAGAAGGATTCGCAG
GACGAGAAATCCAGTGCCAGGAGCGAGGAGTCTGCTGCAGACGCCCAGGAGATGGGCACGTTCGCGGAGGAATCC
AACGCTTGGAGGGAGCAATCGACGGCAGAAGCCAATGAAGATGACGAGTCTGAAGAATCCGAGCCGGAACCGACC
GCAGTCGCCAAAGAGCTGGATACGTTCAAGGAGGAATCCAACGCTTGGAGGGAGCAGTCGGCTGCCGACGCCTCA
GGGGATGAAGAGCCCGAGGCATCTGTGCGGGAGCCGAAGGAGACGGCCGAAGACGCAGACGACGTATCTGCCGAG
GAGAAGACGGCAGAAGACGACGGCTGGGCGGCTGGCGAAAAGAAGGGGGCCGTAGATGGCCGAGAGAATGACAAA
TCTGACGGGCTTCAGGCGAAGGACACGACGGGAGACGCACATGATACCTTGGCAGCGAGGGCAGAGACAGCGGAG
ACGACTCCTGACGCCGAGGGTGATGGACTATCTGCTCTTACTTGGAAGGGGACGACGGCCGAGGCAGAAGACACT
TGCAGCGTCAGGGCAAACGGGACGCCCGCAGCGGCCCAAGAGGGAGACAAGCCGGCAGGATTAAGGCCCAAGGCA
AAGGAGGATGACGCAGAGACAGACGACGCGCCCACGACGGTAAAGGAAAAGACGACAGACGCAGACGACGAGACG
ACGGCCAAGGAAATCATAGCAGACACGCACATGGCATCTAATACGGCGGACGAGGAGAAGTCGACGGAAGACGCA
TCCGCCACCACAGCGAAAAAGAGCCCAGCAGAGGAAGCGGCCACGACAGCCACGGCAAAACAATCGCCTGAAGAT
GACCGCGTCGTCCAAACCTCGGCCAGCGTAAAAGACGCAACCCGCGACCCCAGAGACGAATCCTTCCCCAACCAC
GTCAGGTCGGATCTGCTCGCCGCCCAGGTCGCCCTGCCCGACTCCCCCGCGCCGACGCCGACCAGGGCCGAGGCC
GAGGCTGCGTCTCCCGCGGTTCAGTAG
Gene >Ophio5|4775
ATGAGCGGCGGCGACGATAGCAGCTCCCTGGACGGGGCTCGACAGCTGTCTATCTCGTCGTCGTCGACGCCCTCG
CCCTTTTCGCCTCTCGTCACCGTCGTCGGCTTCCATCATGCCCGTGGCCCCGAGGTCGAGACGTGGTTCGGCGTC
GACGATGGCGCTGATCCTTCCATTGACTTTGCCTGGCCACTGCTCCCCTTCATGGCCTTGAGCGACGGGGCACAC
GCGTCAGTCGCCTGCTTTGCTTGCTTGCCTCAGCCGTTATTGACACTCACTCGACTAGCTCCGAAGAGGACTTTT
CCTACTTTACTCTCCTGAGGCCAGCCACCGACTCGGAGCCGGCAACGTCTCTGTTTGGCATCTCGTGTACCCGAC
AGCTCGACGCGTCCCAACTCCTCAAGCGCCCCGCTGATGTCACGCGCTCCACCGTCCAAAAGGCCGTCGTCGTCA
TCGCCGACACCCCCCAGTTCTTCGGCATGCTGCGCGAGCGGCTGAGCATCGTCACCCAGGCCTGGTTTGCCCAGC
GCGACTTCACAGACGTCGAAATACTGCGTCGCTTCCAAGAGAGCCTCGCGGATGAGAAAGCCAGGGGCACATTGG
CCATAGACGCTACCCGGGACCAATATCTCGGCATGAGTCTCCGCGAGCTCATTCATGAATTCAGGTGGCAGACGC
TGGTTCTCTTCAAGTGCTGTCTTCTGCAGCCCAAGGTGCGTACAGCTGGTCTGTACCTTGTGGCCGACGATGCTG
ACCCGTACTTGTCCAGATGCTCTTCTTTGGCTCCCGCTGCGATAGGCTGTGCATGGTCCAATTCTCCCTCATCTC
GCTCATCCCCGGACTCTTGCGCAGCTTGCAAGACTGCGCAGACCCCGACTTGGACAGCTACGAGAAGAAGCTGTC
GCGGCCTACCAGCCTGCAGAGCAGCAACCGAAGCTCTCTGCTGTCTTTCATGGGGCTTCCCTTGCAAATTTTTGG
CAAGGTCCGATCGGTCGACCATCCCCCTTGACCGCGCCGCTGACCGTCTGAGCGCAGGGCGGATTCTTTGGTCCC
TACACGCCGCTGCAGCAACTCGACATCTTGGCCGACTTCGGCACCAAGTCCTACCTGGTCGGCAGCACCAACTCG
TTGCTTCTGCAGCAGAGGGACCGCTATAGCGACATCCTTATCAATCTGGACGAGGACACCGTCACCATCACGTCG
ACGTCTTTGCGATCTGCCCTGGCCCTGACCGCCGCCGACCGTCGATGGATAGACTTCCTCACCCAGGAGGTCAAC
GAGACCTGGGACGAGACGAACCCGAGCAGGCCCAAGACGATGCAGTACATAGGGAGCGAGGAGTTCATCAGGTCG
CAGTTCGAGTCATACATTCTCGGCTTGATATCCTCGGTCAAGTACCACAACTTCCTTGCCTCCAATGCCGATGGC
ACCAAGGGGGCCGAGGACCCGGCTGTCGACTTTGGCCTGGAGTGGGTTGAGGCCTGGGAGCGCACGGAAAACTAT
CGCATGTGGAATACGCATACCGACGCCAACCTCTTCGCCGTCTCGGAGCCCAAGCATCCTTGCGCCGGCGGCCTC
ACCATCGACGACGTCCAGAGGCGCCTATCCGAACAGGTCAAGGAGCTGCATCTCGACGAGCGTTTCGCCCAGGGC
CGCGAGATCCTTGGCCGCAACTTGGCGGTTGGCCGCGAAAAGGCTTCGACGATGCTCAACAGGCTCTACGCCGAC
GTCGAGTATCTGCGTGAGTCACAGCTCCGCCGTTCCGACGAGGCCAAGCCCGAGGGCTCCAAGTCGCCGCCGGAA
AAGTCCCAAGCGCAGTACTCGGTCGACCTGGCCAAGGCGCAGCAGACGATGCAGTCTGTTGGCGTCAAGGCCGGC
GCCTACATGTCCAGCTGGGCCACCTGGGCGGGCGAGCGGCGCAAAGGCGGCGGATGGGGCGCGGCTTGGGGTAGG
AAGTCCAAGACTGCTTCGGCGCCGGGGAGCCCGGAGAACCAAACGATGAGTCCCGGGTCGTCGAGGACGCCTTCG
ATGGATGATTATGCCAAGAGGCCGCCGACGCAAGCGAGCTTTTGCGAGAGCATTCTCTCTGCCGCGAGCCTCTCT
CAGGATGATAGGCGGGATTCCAAGTCGTCTACCGTGGATTTCCCAGTTGACGGGACGACAGCCGGCGAGAAGGAG
TTGACTGCAGATGTAGGCGCAGCCGGTGGGAGGGGATCGGTCGTGGGCATTTATGAGGAAAAGGAATCCTCGCCC
ACGACGAAGGAGTCGACCACTGACGCACGTGACGAATCCGCGGCCGTCAGCCGAGTATCTTCCGCAGCTGCCCAG
CAGAAGGATTCGCAGGACGAGAAATCCAGTGCCAGGAGCGAGGAGTCTGCTGCAGACGCCCAGGAGATGGGCACG
TTCGCGGAGGAATCCAACGCTTGGAGGGAGCAATCGACGGCAGAAGCCAATGAAGATGACGAGTCTGAAGAATCC
GAGCCGGAACCGACCGCAGTCGCCAAAGAGCTGGATACGTTCAAGGAGGAATCCAACGCTTGGAGGGAGCAGTCG
GCTGCCGACGCCTCAGGGGATGAAGAGCCCGAGGCATCTGTGCGGGAGCCGAAGGAGACGGCCGAAGACGCAGAC
GACGTATCTGCCGAGGAGAAGACGGCAGAAGACGACGGCTGGGCGGCTGGCGAAAAGAAGGGGGCCGTAGATGGC
CGAGAGAATGACAAATCTGACGGGCTTCAGGCGAAGGACACGACGGGAGACGCACATGATACCTTGGCAGCGAGG
GCAGAGACAGCGGAGACGACTCCTGACGCCGAGGGTGATGGACTATCTGCTCTTACTTGGAAGGGGACGACGGCC
GAGGCAGAAGACACTTGCAGCGTCAGGGCAAACGGGACGCCCGCAGCGGCCCAAGAGGGAGACAAGCCGGCAGGA
TTAAGGCCCAAGGCAAAGGAGGATGACGCAGAGACAGACGACGCGCCCACGACGGTAAAGGAAAAGACGACAGAC
GCAGACGACGAGACGACGGCCAAGGAAATCATAGCAGACACGCACATGGCATCTAATACGGCGGACGAGGAGAAG
TCGACGGAAGACGCATCCGCCACCACAGCGAAAAAGAGCCCAGCAGAGGAAGCGGCCACGACAGCCACGGCAAAA
CAATCGCCTGAAGATGACCGCGTCGTCCAAACCTCGGCCAGCGTAAAAGACGCAACCCGCGACCCCAGAGACGAA
TCCTTCCCCAACCACGTCAGGTCGGATCTGCTCGCCGCCCAGGTCGCCCTGCCCGACTCCCCCGCGCCGACGCCG
ACCAGGGCCGAGGCCGAGGCTGCGTCTCCCGCGGTTCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail