Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4765
Gene name
Locationscaffold_380:5870..7426
Strand+
Gene length (bp)1556
Transcript length (bp)1272
Coding sequence length (bp)1269
Protein length (aa) 423

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03381 CDC50 LEM3 (ligand-effect modulator 3) family / CDC50 family 1.5E-95 72 388

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1MTQ5|MUG89_SCHPO Meiotically up-regulated gene 89 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug89 PE=1 SV=1 28 398 2.0E-125
sp|P25656|CDC50_YEAST Cell division control protein 50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC50 PE=1 SV=1 21 397 2.0E-106
sp|Q96WW4|IVN1_SCHPO Invasion protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ivn1 PE=3 SV=1 21 403 2.0E-105
sp|P53740|YN8S_YEAST Uncharacterized protein YNR048W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNR048W PE=1 SV=1 19 397 6.0E-96
sp|P42838|LEM3_YEAST Alkylphosphocholine resistance protein LEM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEM3 PE=1 SV=1 3 398 2.0E-83
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1MTQ5|MUG89_SCHPO Meiotically up-regulated gene 89 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug89 PE=1 SV=1 28 398 2.0E-125
sp|P25656|CDC50_YEAST Cell division control protein 50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC50 PE=1 SV=1 21 397 2.0E-106
sp|Q96WW4|IVN1_SCHPO Invasion protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ivn1 PE=3 SV=1 21 403 2.0E-105
sp|P53740|YN8S_YEAST Uncharacterized protein YNR048W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNR048W PE=1 SV=1 19 397 6.0E-96
sp|P42838|LEM3_YEAST Alkylphosphocholine resistance protein LEM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEM3 PE=1 SV=1 3 398 2.0E-83
sp|Q9LTW0|ALIS1_ARATH ALA-interacting subunit 1 OS=Arabidopsis thaliana GN=ALIS1 PE=1 SV=1 26 404 4.0E-67
sp|Q8L8W0|ALIS5_ARATH ALA-interacting subunit 5 OS=Arabidopsis thaliana GN=ALIS5 PE=1 SV=1 26 399 5.0E-63
sp|Q9SLK2|ALIS3_ARATH ALA-interacting subunit 3 OS=Arabidopsis thaliana GN=ALIS3 PE=1 SV=1 26 404 1.0E-62
sp|Q3MIR4|CC50B_HUMAN Cell cycle control protein 50B OS=Homo sapiens GN=TMEM30B PE=1 SV=1 24 383 1.0E-57
sp|Q9SA35|ALIS4_ARATH Putative ALA-interacting subunit 4 OS=Arabidopsis thaliana GN=ALIS4 PE=2 SV=2 33 399 2.0E-57
sp|Q8BHG3|CC50B_MOUSE Cell cycle control protein 50B OS=Mus musculus GN=Tmem30b PE=2 SV=1 24 383 1.0E-56
sp|Q5F362|CC50A_CHICK Cell cycle control protein 50A OS=Gallus gallus GN=TMEM30A PE=2 SV=1 28 382 2.0E-54
sp|H2L0H3|CHAT1_CAEEL CDC50 family protein chat-1 OS=Caenorhabditis elegans GN=chat-1 PE=2 SV=1 23 383 7.0E-52
sp|Q8VEK0|CC50A_MOUSE Cell cycle control protein 50A OS=Mus musculus GN=Tmem30a PE=1 SV=1 28 382 1.0E-50
sp|Q17QL5|CC50A_BOVIN Cell cycle control protein 50A OS=Bos taurus GN=TMEM30A PE=1 SV=1 28 382 1.0E-49
sp|Q5R6C0|CC50A_PONAB Cell cycle control protein 50A OS=Pongo abelii GN=TMEM30A PE=2 SV=1 28 382 4.0E-49
sp|Q9NV96|CC50A_HUMAN Cell cycle control protein 50A OS=Homo sapiens GN=TMEM30A PE=1 SV=1 28 382 2.0E-48
sp|Q67YS6|ALIS2_ARATH Putative ALA-interacting subunit 2 OS=Arabidopsis thaliana GN=ALIS2 PE=2 SV=1 16 403 6.0E-45
sp|Q2T9P5|CC50C_BOVIN Cell cycle control protein 50C OS=Bos taurus GN=TMEM30C PE=2 SV=1 22 388 3.0E-38
sp|Q95JK4|CC50C_MACFA Cell cycle control protein 50C OS=Macaca fascicularis GN=TMEM30C PE=2 SV=1 18 388 1.0E-35
sp|Q6AY41|CC50A_RAT Cell cycle control protein 50A OS=Rattus norvegicus GN=Tmem30a PE=2 SV=1 157 382 4.0E-35
sp|Q9D4D7|CC50C_MOUSE Cell cycle control protein 50C OS=Mus musculus GN=Tmem30c PE=2 SV=2 29 387 1.0E-31
sp|Q6AY41|CC50A_RAT Cell cycle control protein 50A OS=Rattus norvegicus GN=Tmem30a PE=2 SV=1 28 56 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.5

Transmembrane Domains

Domain # Start End Length
1 53 75 22
2 359 381 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4765
MSDSPPGVGHADSIDSHESSPKHAEKKKSRRPANTAFRQQRLKAWQPILTPKTVLPLFFTIGIIFAPIGGLLIYA
SSRVQEIIIDYSGCINDAEPTIGDIPKDRVYTAFKSNNRTIAVQWSRKMGVSVTIPNSGNVVVPTNQCVIEFDIP
DNLKPPVLFYYKLTNFHQNHRRYVESFDQDQLKGEAVPLDKIKRSKCTPLYGDGDKPYYPCGLIANSLFNDTYTR
PELVNPPGARGNETQTYNMTRNGIAWSSDKALYGKTKYQPNDCLPPPNWALRYPENYTDDNPPPDLKEDEVFQNW
MRTAALPSFSKLYQRNDVEIMRKGRYRVIVNDYFPTSEYKGTKSIVITTRTVMGGRNPFLGIAYLVVGGLCILLG
TIFTVTHLIKPRKLGDHTYLSWNKVPASRPAGPSTAVASGREIRPNEA
Coding >Ophio5|4765
ATGTCCGACTCGCCTCCGGGCGTTGGCCACGCCGACTCCATCGACTCGCATGAGTCGAGTCCCAAGCATGCCGAG
AAGAAGAAGAGCCGCCGGCCCGCGAATACTGCTTTTCGTCAGCAGCGCCTAAAGGCTTGGCAGCCCATCTTGACG
CCAAAGACGGTCCTGCCTTTGTTCTTTACCATCGGAATCATATTCGCTCCTATCGGCGGCTTGCTTATCTATGCC
AGCTCTCGAGTTCAAGAGATCATCATTGATTACTCCGGGTGCATAAACGATGCTGAACCCACCATTGGAGACATC
CCCAAGGATAGAGTCTACACCGCCTTCAAAAGCAACAATAGGACCATCGCCGTCCAGTGGTCTAGAAAAATGGGT
GTCAGCGTCACAATCCCAAACTCCGGCAATGTCGTTGTTCCAACCAATCAATGCGTCATCGAATTCGACATACCA
GACAACTTGAAGCCGCCAGTCCTCTTCTACTACAAGTTGACCAACTTCCACCAGAACCACCGCCGATACGTCGAG
TCTTTCGATCAGGATCAGCTTAAAGGGGAGGCTGTCCCCCTTGACAAGATCAAGCGCTCCAAGTGCACTCCACTC
TATGGCGATGGCGACAAGCCATACTATCCCTGTGGCCTCATCGCCAACTCTCTTTTCAACGACACCTACACCCGA
CCTGAACTGGTCAACCCACCTGGTGCGAGAGGCAACGAGACTCAAACCTACAACATGACTCGAAACGGAATCGCT
TGGAGTAGCGACAAGGCTCTTTACGGCAAGACGAAATATCAGCCCAATGACTGTCTCCCGCCCCCCAACTGGGCC
TTGCGATATCCCGAAAATTACACCGACGACAACCCTCCCCCTGACCTGAAAGAAGACGAGGTCTTCCAGAACTGG
ATGCGCACTGCTGCCCTGCCATCCTTCAGCAAACTTTACCAACGAAACGACGTTGAAATCATGCGCAAAGGCCGC
TATCGGGTCATTGTTAATGACTATTTCCCCACCTCGGAATACAAGGGCACCAAATCCATTGTCATCACCACCCGT
ACCGTCATGGGCGGCCGCAATCCGTTCCTGGGAATTGCTTATCTCGTCGTTGGAGGCCTCTGCATCCTCCTCGGC
ACCATCTTCACCGTGACCCATCTCATCAAGCCGAGAAAACTGGGCGACCACACGTACCTCTCTTGGAATAAAGTT
CCCGCCTCGAGACCGGCAGGTCCCTCAACTGCCGTCGCCTCGGGCCGCGAGATACGTCCCAACGAAGCC
Transcript >Ophio5|4765
ATGTCCGACTCGCCTCCGGGCGTTGGCCACGCCGACTCCATCGACTCGCATGAGTCGAGTCCCAAGCATGCCGAG
AAGAAGAAGAGCCGCCGGCCCGCGAATACTGCTTTTCGTCAGCAGCGCCTAAAGGCTTGGCAGCCCATCTTGACG
CCAAAGACGGTCCTGCCTTTGTTCTTTACCATCGGAATCATATTCGCTCCTATCGGCGGCTTGCTTATCTATGCC
AGCTCTCGAGTTCAAGAGATCATCATTGATTACTCCGGGTGCATAAACGATGCTGAACCCACCATTGGAGACATC
CCCAAGGATAGAGTCTACACCGCCTTCAAAAGCAACAATAGGACCATCGCCGTCCAGTGGTCTAGAAAAATGGGT
GTCAGCGTCACAATCCCAAACTCCGGCAATGTCGTTGTTCCAACCAATCAATGCGTCATCGAATTCGACATACCA
GACAACTTGAAGCCGCCAGTCCTCTTCTACTACAAGTTGACCAACTTCCACCAGAACCACCGCCGATACGTCGAG
TCTTTCGATCAGGATCAGCTTAAAGGGGAGGCTGTCCCCCTTGACAAGATCAAGCGCTCCAAGTGCACTCCACTC
TATGGCGATGGCGACAAGCCATACTATCCCTGTGGCCTCATCGCCAACTCTCTTTTCAACGACACCTACACCCGA
CCTGAACTGGTCAACCCACCTGGTGCGAGAGGCAACGAGACTCAAACCTACAACATGACTCGAAACGGAATCGCT
TGGAGTAGCGACAAGGCTCTTTACGGCAAGACGAAATATCAGCCCAATGACTGTCTCCCGCCCCCCAACTGGGCC
TTGCGATATCCCGAAAATTACACCGACGACAACCCTCCCCCTGACCTGAAAGAAGACGAGGTCTTCCAGAACTGG
ATGCGCACTGCTGCCCTGCCATCCTTCAGCAAACTTTACCAACGAAACGACGTTGAAATCATGCGCAAAGGCCGC
TATCGGGTCATTGTTAATGACTATTTCCCCACCTCGGAATACAAGGGCACCAAATCCATTGTCATCACCACCCGT
ACCGTCATGGGCGGCCGCAATCCGTTCCTGGGAATTGCTTATCTCGTCGTTGGAGGCCTCTGCATCCTCCTCGGC
ACCATCTTCACCGTGACCCATCTCATCAAGCCGAGAAAACTGGGCGACCACACGTACCTCTCTTGGAATAAAGTT
CCCGCCTCGAGACCGGCAGGTCCCTCAACTGCCGTCGCCTCGGGCCGCGAGATACGTCCCAACGAAGCCTAG
Gene >Ophio5|4765
ATGTCCGACTCGCCTCCGGGCGTTGGCCACGCCGACTCCATCGACTCGCATGAGTCGAGTCCCAAGCATGCCGAG
AAGAAGAAGAGCCGCCGGCCCGCGAGTGGGTGTCGTCGGAGCCTGCTGTCGAAATGATGGTGCTGACCAGGTCGT
GACAGATACTGCTTTTCGTCAGCAGCGCCTAAAGGCTTGGCAGTGAGTCCGAGTTCCTTTCGTTGAGGTGACGTT
TGGTATTGATCTCGCAAACAGGCCCATCTTGACGCCAAAGACGGTCCTGCCTTTGTTCTTTACCATCGGAATCAT
ATTCGCTCCTATCGGCGGCTTGCTTATCTATGCCAGCTCTCGAGTTTGTCTCGCCCCTTCCGACCGCTTCTCCAT
TCCTTTTCTGACCTGGTCGCCCGCAAAGGTTCAAGAGATCATCATTGATTACTCCGGGTGCATAAACGATGCTGA
ACCCACCATTGGAGACATCCCCAAGGATAGAGTCTACACCGCCTTCAAAAGCAACAATAGGACCATCGCCGTCCA
GTGGTCTAGAAAAATGGGTGTCAGCGTCACAATCCCAAACTCCGGCAATGTCGTTGTTCCAACCAATCAATGCGT
CATCGAATTCGACATACCAGACAACTTGAAGCCGCCAGTCCTCTTCTACTACAAGTTGACCAACTTCCACCAGAA
CCACCGCCGATACGTCGAGTCTTTCGATCAGGATCAGCTTAAAGGGGAGGCTGTCCCCCTTGACAAGATCAAGCG
CTCCAAGTGCACTCCACTCTATGGCGATGGCGACAAGCCATACTATCCCTGTGGCCTCATCGCCAACTCTCTTTT
CAACGACACCTACACCCGACCTGAACTGGTCAACCCACCTGGTGCGAGAGGCAACGAGACTCAAACCTACAACAT
GACTCGAAACGGAATCGCTTGGAGTAGCGACAAGGCTCTTTACGGCAAGACGAAATATCAGCCCAATGACTGTCT
CCCGCCCCCCAACTGGGCCTTGCGATATCCCGAAAATTACACCGACGACAACCCTCCCCCTGACCTGAAAGAAGA
CGAGGTCTTCCAGAACTGGATGCGCACTGCTGCCCTGCCATCCTTCAGCAAACTTTACCAACGAAACGACGTTGA
AATCATGCGCAAAGGCCGCTATCGGGTCATTGTTAATGACTGTAAGTCCACTGGGCAGCCCGAGCCGTGCTTCCG
CTGATGACCTTTGCCCAGATTTCCCCACCTCGGAATACAAGGGCACCAAATCCATTGTCATCACCACCCGTACCG
TCATGGGCGGCCGCAATCCGTTCCTGGGAATTGCTTATCTCGTCGTTGGAGGCCTCTGCATCCTCCTCGGCACCA
TCTTCACCGTGACCCATCTCATCAAGCCGAGGTCAGAAGCACCCCCCTTCTTTATTCCCTCCCTTTGCTTGTCTC
GTCGCTGATTCTGGAGCAGAAAACTGGGCGACCACACGTACCTCTCTTGGAATAAAGTTCCCGCCTCGAGACCGG
CAGGTCCCTCAACTGCCGTCGCCTCGGGCCGCGAGATACGTCCCAACGAAGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail