Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4756
Gene name
Locationscaffold_38:59058..60672
Strand+
Gene length (bp)1614
Transcript length (bp)1614
Coding sequence length (bp)1611
Protein length (aa) 537

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

Domain # Start End Length
1 28 47 19
2 67 89 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 12.43 5.20 19.66
CcL In ants, during behavior modification 7.69 2.04 13.33
CcD In ants, recently dead 5.99 1.98 9.99

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.142293 no
SC16a CcD 0.015527 yes
CcL CcD 0.517300 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4756
MFRAESVGLPEQTSTCILFFPLPLPSPLRLSGSLSLSLSFSLPLSLIRSNLDGRMADSAGWHVFRNLFLLSLSLA
LLPISTTIIAALTVRKRLARRNEPAPSAGRKTVLVTGVGMSKGLFLARMFHRRGHRVIGADCSALSPGRVSVSLD
RFYVLPRPERFSVDESRRDPYVLRLLDIVRSEGVNLWVSVSDVSAAAQDALARDLIQDDTTKAKVVQLSLADVQT
LHEKDSFMRHVEGLGLPTPDTQVVSNRAAMIDFLLQRGGLRLEAGGAQYLVKPIGVNDQARFNMPLLPLPTEAET
MRRIDSVPLDGDSRFVMQEFIRGPEFCTHALVVRGQVRAFVACPSSDLLMHYTALSRDSPLSSKMLAFTKTVAMA
GGLEWTGHVSFDFLLRGDQLYPIECNPRVHTAIVLFHDTPQMVDEYLRVLKNTDSSGSEEVLSPNLPRRYYWIGQ
DLVEKVISPLYQSLTLRGESPSQLRSSLASFAHHVWCFKDGTFEAWDPWPWWWLYHVYWPLQFLALLARGERWNR
LNVSTGKVFKTS
Coding >Ophio5|4756
ATGTTCCGTGCGGAATCGGTTGGACTGCCGGAGCAAACGTCAACCTGCATCCTCTTTTTCCCTCTCCCTCTCCCT
TCCCCTCTCCGTCTCTCCGGCTCTCTCTCTCTCTCTCTCTCTTTCTCTCTCCCTCTCTCTCTAATCCGGTCAAAC
CTTGACGGCAGAATGGCCGACTCGGCCGGCTGGCACGTCTTCAGGAACTTGTTTCTCCTTTCCCTCAGCCTGGCA
CTGCTGCCAATCAGCACGACCATCATTGCCGCCCTGACGGTGAGAAAGCGACTGGCACGGCGTAATGAGCCGGCC
CCAAGCGCCGGCCGCAAGACGGTCCTGGTCACGGGCGTCGGCATGTCCAAAGGCCTCTTCTTAGCCCGAATGTTT
CATCGCCGCGGTCATAGGGTTATTGGTGCCGACTGCAGCGCCCTTTCGCCTGGCCGGGTTTCCGTGTCACTTGAC
AGATTCTATGTGCTTCCCCGGCCTGAGAGGTTTTCCGTCGACGAGTCCCGTCGTGACCCGTACGTGCTCCGGCTT
CTAGACATTGTCCGCAGCGAAGGGGTGAATCTCTGGGTTTCCGTGTCGGACGTCAGCGCCGCCGCTCAAGATGCG
CTCGCCAGGGACCTTATCCAAGACGACACCACAAAGGCCAAGGTTGTCCAGCTGAGTCTTGCTGATGTACAGACA
TTGCACGAAAAGGACAGCTTCATGCGGCACGTTGAGGGTCTGGGGCTGCCAACACCAGACACTCAGGTCGTCTCC
AACAGAGCGGCCATGATTGATTTCCTGCTTCAGAGAGGAGGCCTTCGACTGGAGGCTGGCGGAGCTCAATATCTG
GTGAAGCCGATCGGGGTAAACGATCAGGCTCGCTTCAACATGCCTCTGCTGCCGCTTCCGACCGAGGCGGAAACC
ATGCGTCGGATCGACTCAGTTCCTCTGGATGGCGATTCTCGTTTCGTCATGCAAGAGTTTATCAGAGGGCCCGAA
TTTTGCACTCACGCGCTCGTGGTTCGGGGCCAGGTGCGTGCCTTTGTAGCCTGTCCTTCCTCGGACTTGTTGATG
CATTATACCGCTCTGTCTCGAGATTCGCCGCTCAGCAGCAAGATGCTCGCCTTCACCAAGACGGTCGCCATGGCT
GGCGGCTTGGAGTGGACGGGCCACGTCAGCTTCGACTTTCTGCTCAGGGGTGACCAACTGTATCCGATCGAGTGC
AATCCGAGGGTGCACACAGCCATTGTGCTCTTCCACGACACGCCTCAGATGGTCGACGAGTACCTGAGAGTGCTG
AAGAATACGGATTCATCAGGTAGCGAAGAGGTCTTGTCGCCGAATCTGCCGCGGCGGTACTACTGGATCGGCCAA
GACTTGGTTGAAAAAGTCATCAGTCCTCTCTATCAGTCTCTCACTTTACGGGGAGAGAGTCCGTCGCAGCTGAGG
TCGAGTCTCGCCTCGTTCGCCCACCACGTCTGGTGTTTCAAAGACGGCACTTTTGAGGCGTGGGATCCGTGGCCG
TGGTGGTGGCTCTATCATGTGTATTGGCCACTGCAGTTCCTGGCGCTGCTTGCACGAGGAGAGCGATGGAATAGG
CTCAATGTTAGCACCGGAAAGGTGTTTAAGACCAGT
Transcript >Ophio5|4756
ATGTTCCGTGCGGAATCGGTTGGACTGCCGGAGCAAACGTCAACCTGCATCCTCTTTTTCCCTCTCCCTCTCCCT
TCCCCTCTCCGTCTCTCCGGCTCTCTCTCTCTCTCTCTCTCTTTCTCTCTCCCTCTCTCTCTAATCCGGTCAAAC
CTTGACGGCAGAATGGCCGACTCGGCCGGCTGGCACGTCTTCAGGAACTTGTTTCTCCTTTCCCTCAGCCTGGCA
CTGCTGCCAATCAGCACGACCATCATTGCCGCCCTGACGGTGAGAAAGCGACTGGCACGGCGTAATGAGCCGGCC
CCAAGCGCCGGCCGCAAGACGGTCCTGGTCACGGGCGTCGGCATGTCCAAAGGCCTCTTCTTAGCCCGAATGTTT
CATCGCCGCGGTCATAGGGTTATTGGTGCCGACTGCAGCGCCCTTTCGCCTGGCCGGGTTTCCGTGTCACTTGAC
AGATTCTATGTGCTTCCCCGGCCTGAGAGGTTTTCCGTCGACGAGTCCCGTCGTGACCCGTACGTGCTCCGGCTT
CTAGACATTGTCCGCAGCGAAGGGGTGAATCTCTGGGTTTCCGTGTCGGACGTCAGCGCCGCCGCTCAAGATGCG
CTCGCCAGGGACCTTATCCAAGACGACACCACAAAGGCCAAGGTTGTCCAGCTGAGTCTTGCTGATGTACAGACA
TTGCACGAAAAGGACAGCTTCATGCGGCACGTTGAGGGTCTGGGGCTGCCAACACCAGACACTCAGGTCGTCTCC
AACAGAGCGGCCATGATTGATTTCCTGCTTCAGAGAGGAGGCCTTCGACTGGAGGCTGGCGGAGCTCAATATCTG
GTGAAGCCGATCGGGGTAAACGATCAGGCTCGCTTCAACATGCCTCTGCTGCCGCTTCCGACCGAGGCGGAAACC
ATGCGTCGGATCGACTCAGTTCCTCTGGATGGCGATTCTCGTTTCGTCATGCAAGAGTTTATCAGAGGGCCCGAA
TTTTGCACTCACGCGCTCGTGGTTCGGGGCCAGGTGCGTGCCTTTGTAGCCTGTCCTTCCTCGGACTTGTTGATG
CATTATACCGCTCTGTCTCGAGATTCGCCGCTCAGCAGCAAGATGCTCGCCTTCACCAAGACGGTCGCCATGGCT
GGCGGCTTGGAGTGGACGGGCCACGTCAGCTTCGACTTTCTGCTCAGGGGTGACCAACTGTATCCGATCGAGTGC
AATCCGAGGGTGCACACAGCCATTGTGCTCTTCCACGACACGCCTCAGATGGTCGACGAGTACCTGAGAGTGCTG
AAGAATACGGATTCATCAGGTAGCGAAGAGGTCTTGTCGCCGAATCTGCCGCGGCGGTACTACTGGATCGGCCAA
GACTTGGTTGAAAAAGTCATCAGTCCTCTCTATCAGTCTCTCACTTTACGGGGAGAGAGTCCGTCGCAGCTGAGG
TCGAGTCTCGCCTCGTTCGCCCACCACGTCTGGTGTTTCAAAGACGGCACTTTTGAGGCGTGGGATCCGTGGCCG
TGGTGGTGGCTCTATCATGTGTATTGGCCACTGCAGTTCCTGGCGCTGCTTGCACGAGGAGAGCGATGGAATAGG
CTCAATGTTAGCACCGGAAAGGTGTTTAAGACCAGTTGA
Gene >Ophio5|4756
ATGTTCCGTGCGGAATCGGTTGGACTGCCGGAGCAAACGTCAACCTGCATCCTCTTTTTCCCTCTCCCTCTCCCT
TCCCCTCTCCGTCTCTCCGGCTCTCTCTCTCTCTCTCTCTCTTTCTCTCTCCCTCTCTCTCTAATCCGGTCAAAC
CTTGACGGCAGAATGGCCGACTCGGCCGGCTGGCACGTCTTCAGGAACTTGTTTCTCCTTTCCCTCAGCCTGGCA
CTGCTGCCAATCAGCACGACCATCATTGCCGCCCTGACGGTGAGAAAGCGACTGGCACGGCGTAATGAGCCGGCC
CCAAGCGCCGGCCGCAAGACGGTCCTGGTCACGGGCGTCGGCATGTCCAAAGGCCTCTTCTTAGCCCGAATGTTT
CATCGCCGCGGTCATAGGGTTATTGGTGCCGACTGCAGCGCCCTTTCGCCTGGCCGGGTTTCCGTGTCACTTGAC
AGATTCTATGTGCTTCCCCGGCCTGAGAGGTTTTCCGTCGACGAGTCCCGTCGTGACCCGTACGTGCTCCGGCTT
CTAGACATTGTCCGCAGCGAAGGGGTGAATCTCTGGGTTTCCGTGTCGGACGTCAGCGCCGCCGCTCAAGATGCG
CTCGCCAGGGACCTTATCCAAGACGACACCACAAAGGCCAAGGTTGTCCAGCTGAGTCTTGCTGATGTACAGACA
TTGCACGAAAAGGACAGCTTCATGCGGCACGTTGAGGGTCTGGGGCTGCCAACACCAGACACTCAGGTCGTCTCC
AACAGAGCGGCCATGATTGATTTCCTGCTTCAGAGAGGAGGCCTTCGACTGGAGGCTGGCGGAGCTCAATATCTG
GTGAAGCCGATCGGGGTAAACGATCAGGCTCGCTTCAACATGCCTCTGCTGCCGCTTCCGACCGAGGCGGAAACC
ATGCGTCGGATCGACTCAGTTCCTCTGGATGGCGATTCTCGTTTCGTCATGCAAGAGTTTATCAGAGGGCCCGAA
TTTTGCACTCACGCGCTCGTGGTTCGGGGCCAGGTGCGTGCCTTTGTAGCCTGTCCTTCCTCGGACTTGTTGATG
CATTATACCGCTCTGTCTCGAGATTCGCCGCTCAGCAGCAAGATGCTCGCCTTCACCAAGACGGTCGCCATGGCT
GGCGGCTTGGAGTGGACGGGCCACGTCAGCTTCGACTTTCTGCTCAGGGGTGACCAACTGTATCCGATCGAGTGC
AATCCGAGGGTGCACACAGCCATTGTGCTCTTCCACGACACGCCTCAGATGGTCGACGAGTACCTGAGAGTGCTG
AAGAATACGGATTCATCAGGTAGCGAAGAGGTCTTGTCGCCGAATCTGCCGCGGCGGTACTACTGGATCGGCCAA
GACTTGGTTGAAAAAGTCATCAGTCCTCTCTATCAGTCTCTCACTTTACGGGGAGAGAGTCCGTCGCAGCTGAGG
TCGAGTCTCGCCTCGTTCGCCCACCACGTCTGGTGTTTCAAAGACGGCACTTTTGAGGCGTGGGATCCGTGGCCG
TGGTGGTGGCTCTATCATGTGTATTGGCCACTGCAGTTCCTGGCGCTGCTTGCACGAGGAGAGCGATGGAATAGG
CTCAATGTTAGCACCGGAAAGGTGTTTAAGACCAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail