Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4753
Gene name
Locationscaffold_38:51577..54950
Strand+
Gene length (bp)3373
Transcript length (bp)3318
Coding sequence length (bp)3315
Protein length (aa) 1105

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00072 Response_reg Response regulator receiver domain 2.1E-27 975 1090
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 2.8E-23 693 886
PF00512 HisKA His Kinase A (phospho-acceptor) domain 2.3E-14 550 612

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4U6|TCSB_EMENI Two-component system protein B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsB PE=1 SV=2 29 1098 0.0E+00
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 492 885 2.0E-61
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 1 736 9.0E-56
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 973 1090 3.0E-34
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 972 1094 3.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4U6|TCSB_EMENI Two-component system protein B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsB PE=1 SV=2 29 1098 0.0E+00
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 492 885 2.0E-61
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 1 736 9.0E-56
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 973 1090 3.0E-34
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 972 1094 3.0E-34
sp|Q9C5U1|AHK3_ARATH Histidine kinase 3 OS=Arabidopsis thaliana GN=AHK3 PE=1 SV=1 528 881 2.0E-30
sp|A1A699|OHK6_ORYSJ Probable histidine kinase 6 OS=Oryza sativa subsp. japonica GN=HK6 PE=1 SV=1 528 904 6.0E-29
sp|A1A698|OHK4_ORYSJ Probable histidine kinase 4 OS=Oryza sativa subsp. japonica GN=HK4 PE=2 SV=1 528 886 4.0E-28
sp|Q5AHA0|CHK1_CANAL Histidine protein kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHK1 PE=2 SV=1 810 1097 2.0E-26
sp|A1A697|OHK5_ORYSJ Probable histidine kinase 5 OS=Oryza sativa subsp. japonica GN=HK5 PE=2 SV=1 523 886 5.0E-26
sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 529 879 4.0E-25
sp|Q9C5U2|AHK2_ARATH Histidine kinase 2 OS=Arabidopsis thaliana GN=AHK2 PE=1 SV=1 528 881 7.0E-25
sp|A3BE68|OHK1_ORYSJ Probable histidine kinase 1 OS=Oryza sativa subsp. japonica GN=HK1 PE=2 SV=1 514 886 4.0E-24
sp|A2YFR6|OHK1_ORYSI Probable histidine kinase 1 OS=Oryza sativa subsp. indica GN=HK1 PE=3 SV=1 514 886 5.0E-24
sp|A1A696|OHK3_ORYSJ Probable histidine kinase 3 OS=Oryza sativa subsp. japonica GN=HK3 PE=2 SV=1 529 901 5.0E-24
sp|A2WYI4|OHK3_ORYSI Probable histidine kinase 3 OS=Oryza sativa subsp. indica GN=HK3 PE=2 SV=1 529 901 1.0E-23
sp|Q3S4A7|AHK5_ARATH Histidine kinase 5 OS=Arabidopsis thaliana GN=AHK5 PE=1 SV=1 554 886 1.0E-23
sp|Q9SXL4|AHK1_ARATH Histidine kinase 1 OS=Arabidopsis thaliana GN=AHK1 PE=1 SV=2 531 885 3.0E-22
sp|P0C0F7|RPFC_XANC8 Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpfC PE=3 SV=2 812 1091 7.0E-22
sp|P0C0F6|RPFC_XANCP Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpfC PE=1 SV=2 812 1091 7.0E-22
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 808 885 6.0E-20
sp|Q54Q69|DHKG_DICDI Hybrid signal transduction histidine kinase G OS=Dictyostelium discoideum GN=dhkG PE=3 SV=1 539 894 4.0E-19
sp|Q9KLK7|LUXQ_VIBCH Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=luxQ PE=1 SV=1 815 1090 5.0E-19
sp|O49187|ETR2_SOLLC Ethylene receptor 2 OS=Solanum lycopersicum GN=ETR2 PE=2 SV=1 537 1096 4.0E-18
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 1 427 5.0E-18
sp|Q41342|ETR1_SOLLC Ethylene receptor 1 OS=Solanum lycopersicum GN=ETR1 PE=1 SV=1 496 885 6.0E-18
sp|Q86CZ2|DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum GN=dhkK PE=1 SV=1 814 1096 1.0E-17
sp|O48929|ETR1_TOBAC Ethylene receptor OS=Nicotiana tabacum GN=ETR1 PE=2 SV=1 496 878 7.0E-17
sp|Q86AT9|DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum GN=dhkI-1 PE=3 SV=1 974 1102 2.0E-16
sp|Q9SSY6|ETR1_CUCSA Ethylene receptor 1 OS=Cucumis sativus GN=ETR1 PE=2 SV=1 537 885 2.0E-16
sp|Q54U87|DHKA_DICDI Hybrid signal transduction histidine kinase A OS=Dictyostelium discoideum GN=dhkA PE=1 SV=1 967 1091 4.0E-16
sp|Q9XH57|ETR2_PELHO Ethylene receptor 2 OS=Pelargonium hortorum GN=ETR2 PE=2 SV=1 496 883 5.0E-16
sp|Q87GU5|LUXQ_VIBPA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=luxQ PE=3 SV=1 535 886 9.0E-16
sp|Q9P896|TCSA_EMENI Two-component system protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsA PE=3 SV=2 815 1090 2.0E-15
sp|Q9HUI3|ARUS_PSEAE Sensor histidine kinase AruS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruS PE=3 SV=1 471 723 2.0E-15
sp|Q54RP6|DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum GN=dhkL PE=3 SV=1 974 1090 4.0E-15
sp|Q86CZ2|DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum GN=dhkK PE=1 SV=1 475 728 7.0E-15
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 811 884 4.0E-14
sp|Q9M7M1|ETR1_PRUPE Ethylene receptor OS=Prunus persica GN=ETR1 PE=2 SV=1 496 871 1.0E-13
sp|Q56128|RCSC_SALTI Sensor histidine kinase RcsC OS=Salmonella typhi GN=rcsC PE=3 SV=2 951 1102 1.0E-13
sp|B8AY75|ERS2_ORYSI Probable ethylene response sensor 2 OS=Oryza sativa subsp. indica GN=ERS2 PE=2 SV=1 507 894 2.0E-13
sp|P59342|BARA_SHIFL Signal transduction histidine-protein kinase BarA OS=Shigella flexneri GN=barA PE=3 SV=1 528 723 2.0E-13
sp|P37894|PLEC_CAUCR Non-motile and phage-resistance protein OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pleC PE=1 SV=2 528 722 2.0E-13
sp|P0AEC5|BARA_ECOLI Signal transduction histidine-protein kinase BarA OS=Escherichia coli (strain K12) GN=barA PE=1 SV=1 528 723 2.0E-13
sp|P0AEC6|BARA_ECOL6 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=barA PE=1 SV=1 528 723 2.0E-13
sp|P0AEC7|BARA_ECO57 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O157:H7 GN=barA PE=3 SV=1 528 723 2.0E-13
sp|A6X5X4|PDHS_OCHA4 Cell-division control histidine kinase PdhS OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pdhS PE=3 SV=1 536 719 2.0E-13
sp|Q0DKM0|ERS2_ORYSJ Probable ethylene response sensor 2 OS=Oryza sativa subsp. japonica GN=ERS2 PE=2 SV=1 507 894 2.0E-13
sp|A9M715|PDHS_BRUC2 Cell-division control histidine kinase PdhS OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pdhS PE=3 SV=1 536 719 3.0E-13
sp|P0DMC6|RCSC_ECOLX Sensor histidine kinase RcsC OS=Escherichia coli GN=rcsC PE=1 SV=1 816 885 3.0E-13
sp|P0DMC5|RCSC_ECOLI Sensor histidine kinase RcsC OS=Escherichia coli (strain K12) GN=rcsC PE=1 SV=1 816 885 3.0E-13
sp|Q56128|RCSC_SALTI Sensor histidine kinase RcsC OS=Salmonella typhi GN=rcsC PE=3 SV=2 816 885 4.0E-13
sp|Q8YIM6|PDHS_BRUME Cell-division control histidine kinase PdhS OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pdhS PE=3 SV=2 536 719 4.0E-13
sp|Q57BR6|PDHS_BRUAB Cell-division control histidine kinase PdhS OS=Brucella abortus biovar 1 (strain 9-941) GN=pdhS PE=1 SV=1 536 719 4.0E-13
sp|Q2YRB4|PDHS_BRUA2 Cell-division control histidine kinase PdhS OS=Brucella abortus (strain 2308) GN=pdhS PE=3 SV=1 536 719 4.0E-13
sp|B2S758|PDHS_BRUA1 Cell-division control histidine kinase PdhS OS=Brucella abortus (strain S19) GN=pdhS PE=3 SV=1 536 719 4.0E-13
sp|Q8FZ86|PDHS_BRUSU Cell-division control histidine kinase PdhS OS=Brucella suis biovar 1 (strain 1330) GN=pdhS PE=3 SV=1 536 719 4.0E-13
sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 536 732 4.0E-13
sp|P58662|RCSC_SALTY Sensor histidine kinase RcsC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rcsC PE=3 SV=1 816 885 4.0E-13
sp|P58662|RCSC_SALTY Sensor histidine kinase RcsC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rcsC PE=3 SV=1 951 1102 4.0E-13
sp|P58356|TORS_ECO57 Sensor protein TorS OS=Escherichia coli O157:H7 GN=torS PE=3 SV=1 323 728 4.0E-13
sp|B0CI82|PDHS_BRUSI Cell-division control histidine kinase PdhS OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=pdhS PE=3 SV=1 536 719 4.0E-13
sp|O22267|CKI1_ARATH Histidine kinase CKI1 OS=Arabidopsis thaliana GN=CKI1 PE=1 SV=1 542 894 4.0E-13
sp|Q8D5Z6|LUXQ_VIBVU Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain CMCP6) GN=luxQ PE=3 SV=1 532 741 5.0E-13
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 540 724 5.0E-13
sp|Q54U87|DHKA_DICDI Hybrid signal transduction histidine kinase A OS=Dictyostelium discoideum GN=dhkA PE=1 SV=1 492 714 6.0E-13
sp|P39453|TORS_ECOLI Sensor protein TorS OS=Escherichia coli (strain K12) GN=torS PE=1 SV=4 323 728 6.0E-13
sp|Q7MD16|LUXQ_VIBVY Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain YJ016) GN=luxQ PE=3 SV=1 532 741 7.0E-13
sp|Q54U87|DHKA_DICDI Hybrid signal transduction histidine kinase A OS=Dictyostelium discoideum GN=dhkA PE=1 SV=1 803 885 8.0E-13
sp|A5VRX4|PDHS_BRUO2 Cell-division control histidine kinase PdhS OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=pdhS PE=3 SV=1 536 727 1.0E-12
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 539 724 2.0E-12
sp|P26762|BVGS_BORBR Virulence sensor protein BvgS OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=bvgS PE=3 SV=2 499 723 2.0E-12
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 974 1082 3.0E-12
sp|P0DMC5|RCSC_ECOLI Sensor histidine kinase RcsC OS=Escherichia coli (strain K12) GN=rcsC PE=1 SV=1 973 1101 3.0E-12
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 814 886 3.0E-12
sp|P40330|BVGS_BORPA Virulence sensor protein BvgS OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=bvgS PE=3 SV=2 499 723 3.0E-12
sp|Q86AT9|DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum GN=dhkI-1 PE=3 SV=1 530 712 4.0E-12
sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 974 1090 4.0E-12
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 810 879 4.0E-12
sp|Q869S5|DOKA_DICDI Hybrid signal transduction protein dokA OS=Dictyostelium discoideum GN=dokA PE=1 SV=1 814 883 4.0E-12
sp|P49333|ETR1_ARATH Ethylene receptor 1 OS=Arabidopsis thaliana GN=ETR1 PE=1 SV=1 496 1095 4.0E-12
sp|Q9KM66|CQSS_VIBCH CAI-1 autoinducer sensor kinase/phosphatase CqsS OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cqsS PE=1 SV=1 970 1092 4.0E-12
sp|Q55E44|DHKE_DICDI Hybrid signal transduction histidine kinase E OS=Dictyostelium discoideum GN=dhkE PE=3 SV=1 972 1090 6.0E-12
sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 974 1091 9.0E-12
sp|Q9HUI3|ARUS_PSEAE Sensor histidine kinase AruS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruS PE=3 SV=1 812 885 9.0E-12
sp|P0DMC6|RCSC_ECOLX Sensor histidine kinase RcsC OS=Escherichia coli GN=rcsC PE=1 SV=1 973 1101 9.0E-12
sp|O22267|CKI1_ARATH Histidine kinase CKI1 OS=Arabidopsis thaliana GN=CKI1 PE=1 SV=1 974 1101 1.0E-11
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 972 1097 1.0E-11
sp|P16575|BVGS_BORPE Virulence sensor protein BvgS OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=bvgS PE=1 SV=3 499 723 1.0E-11
sp|P54302|LUXQ_VIBHA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio harveyi GN=luxQ PE=1 SV=1 535 740 2.0E-11
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 536 732 3.0E-11
sp|A1TEL7|MPRA_MYCVP Response regulator MprA OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=mprA PE=3 SV=1 973 1091 3.0E-11
sp|Q8D5Z6|LUXQ_VIBVU Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain CMCP6) GN=luxQ PE=3 SV=1 805 886 5.0E-11
sp|Q7MD16|LUXQ_VIBVY Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain YJ016) GN=luxQ PE=3 SV=1 805 886 5.0E-11
sp|Q9ZTP3|EIN4_ARATH Protein EIN4 OS=Arabidopsis thaliana GN=EIN4 PE=1 SV=1 519 1081 5.0E-11
sp|Q8D0P1|CHEY_YERPE Chemotaxis protein CheY OS=Yersinia pestis GN=cheY PE=3 SV=3 973 1097 5.0E-11
sp|P38889|SKN7_YEAST Transcription factor SKN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKN7 PE=1 SV=1 905 1096 5.0E-11
sp|P0C0F6|RPFC_XANCP Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpfC PE=1 SV=2 535 723 6.0E-11
sp|P59342|BARA_SHIFL Signal transduction histidine-protein kinase BarA OS=Shigella flexneri GN=barA PE=3 SV=1 973 1090 6.0E-11
sp|P0AEC5|BARA_ECOLI Signal transduction histidine-protein kinase BarA OS=Escherichia coli (strain K12) GN=barA PE=1 SV=1 973 1090 6.0E-11
sp|P0AEC6|BARA_ECOL6 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=barA PE=1 SV=1 973 1090 6.0E-11
sp|P0AEC7|BARA_ECO57 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O157:H7 GN=barA PE=3 SV=1 973 1090 6.0E-11
sp|Q5SML4|OHK2_ORYSJ Probable histidine kinase 2 OS=Oryza sativa subsp. japonica GN=HK2 PE=2 SV=1 965 1093 6.0E-11
sp|A2YA15|OHK2_ORYSI Probable histidine kinase 2 OS=Oryza sativa subsp. indica GN=HK2 PE=3 SV=1 965 1093 6.0E-11
sp|Q1B3X8|MPRA_MYCSS Response regulator MprA OS=Mycobacterium sp. (strain MCS) GN=mprA PE=3 SV=1 973 1091 6.0E-11
sp|A1UL70|MPRA_MYCSK Response regulator MprA OS=Mycobacterium sp. (strain KMS) GN=mprA PE=3 SV=1 973 1091 6.0E-11
sp|A3Q5L9|MPRA_MYCSJ Response regulator MprA OS=Mycobacterium sp. (strain JLS) GN=mprA PE=3 SV=1 973 1091 6.0E-11
sp|Q9C5U1|AHK3_ARATH Histidine kinase 3 OS=Arabidopsis thaliana GN=AHK3 PE=1 SV=1 974 1088 7.0E-11
sp|P0C0F7|RPFC_XANC8 Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpfC PE=3 SV=2 535 723 7.0E-11
sp|A1A697|OHK5_ORYSJ Probable histidine kinase 5 OS=Oryza sativa subsp. japonica GN=HK5 PE=2 SV=1 960 1095 8.0E-11
sp|P54302|LUXQ_VIBHA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio harveyi GN=luxQ PE=1 SV=1 815 886 8.0E-11
sp|Q551X9|DHKF_DICDI Hybrid signal transduction histidine kinase F OS=Dictyostelium discoideum GN=dhkF PE=3 SV=1 969 1095 8.0E-11
sp|P58662|RCSC_SALTY Sensor histidine kinase RcsC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rcsC PE=3 SV=1 542 728 9.0E-11
sp|Q53RH0|ERS1_ORYSJ Probable ethylene response sensor 1 OS=Oryza sativa subsp. japonica GN=ERS1 PE=2 SV=1 496 721 9.0E-11
sp|A2XL32|ERS1_ORYSI Probable ethylene response sensor 1 OS=Oryza sativa subsp. indica GN=ERS1 PE=2 SV=1 496 721 9.0E-11
sp|A1A699|OHK6_ORYSJ Probable histidine kinase 6 OS=Oryza sativa subsp. japonica GN=HK6 PE=1 SV=1 975 1094 1.0E-10
sp|Q56128|RCSC_SALTI Sensor histidine kinase RcsC OS=Salmonella typhi GN=rcsC PE=3 SV=2 542 728 1.0E-10
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 956 1094 1.0E-10
sp|Q869S5|DOKA_DICDI Hybrid signal transduction protein dokA OS=Dictyostelium discoideum GN=dokA PE=1 SV=1 533 713 1.0E-10
sp|Q9P7Q7|MAK1_SCHPO Peroxide stress-activated histidine kinase mak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak1 PE=3 SV=1 973 1094 1.0E-10
sp|P58402|EVGS_ECO57 Sensor protein EvgS OS=Escherichia coli O157:H7 GN=evgS PE=3 SV=1 947 1093 1.0E-10
sp|P30855|EVGS_ECOLI Sensor protein EvgS OS=Escherichia coli (strain K12) GN=evgS PE=1 SV=2 947 1093 1.0E-10
sp|Q869S5|DOKA_DICDI Hybrid signal transduction protein dokA OS=Dictyostelium discoideum GN=dokA PE=1 SV=1 975 1100 2.0E-10
sp|Q9FXD6|ARR11_ARATH Two-component response regulator ARR11 OS=Arabidopsis thaliana GN=ARR11 PE=1 SV=1 973 1103 2.0E-10
sp|Q5A4X5|SKN7_CANAL Transcription factor SKN7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SKN7 PE=3 SV=1 972 1094 2.0E-10
sp|Q54SP4|DHKD_DICDI Hybrid signal transduction histidine kinase D OS=Dictyostelium discoideum GN=dhkD PE=2 SV=1 507 729 3.0E-10
sp|Q54SK5|DHKM_DICDI Hybrid signal transduction histidine kinase M OS=Dictyostelium discoideum GN=dhkM PE=3 SV=1 975 1094 3.0E-10
sp|P59342|BARA_SHIFL Signal transduction histidine-protein kinase BarA OS=Shigella flexneri GN=barA PE=3 SV=1 812 885 4.0E-10
sp|P0AEC5|BARA_ECOLI Signal transduction histidine-protein kinase BarA OS=Escherichia coli (strain K12) GN=barA PE=1 SV=1 812 885 4.0E-10
sp|P0AEC6|BARA_ECOL6 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=barA PE=1 SV=1 812 885 4.0E-10
sp|P0AEC7|BARA_ECO57 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O157:H7 GN=barA PE=3 SV=1 812 885 4.0E-10
sp|P39453|TORS_ECOLI Sensor protein TorS OS=Escherichia coli (strain K12) GN=torS PE=1 SV=4 815 886 4.0E-10
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 811 884 4.0E-10
sp|P0C5S6|LUXN_VIBHA Autoinducer 1 sensor kinase/phosphatase LuxN OS=Vibrio harveyi GN=luxN PE=3 SV=1 789 1103 4.0E-10
sp|A7MRY4|LUXN_VIBCB Autoinducer 1 sensor kinase/phosphatase LuxN OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=luxN PE=1 SV=1 789 1103 4.0E-10
sp|P58356|TORS_ECO57 Sensor protein TorS OS=Escherichia coli O157:H7 GN=torS PE=3 SV=1 815 886 5.0E-10
sp|Q742C1|MPRA_MYCPA Response regulator MprA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mprA PE=3 SV=1 973 1093 5.0E-10
sp|A0QBQ9|MPRA_MYCA1 Response regulator MprA OS=Mycobacterium avium (strain 104) GN=mprA PE=3 SV=1 973 1093 5.0E-10
sp|A0R3I8|MPRA_MYCS2 Response regulator MprA OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mprA PE=1 SV=1 973 1091 5.0E-10
sp|Q75KW7|ORR41_ORYSJ Two-component response regulator ORR41 OS=Oryza sativa subsp. japonica GN=RR41 PE=3 SV=1 963 1091 6.0E-10
sp|A1A696|OHK3_ORYSJ Probable histidine kinase 3 OS=Oryza sativa subsp. japonica GN=HK3 PE=2 SV=1 974 1095 7.0E-10
sp|A2WYI4|OHK3_ORYSI Probable histidine kinase 3 OS=Oryza sativa subsp. indica GN=HK3 PE=2 SV=1 974 1095 7.0E-10
sp|Q551X9|DHKF_DICDI Hybrid signal transduction histidine kinase F OS=Dictyostelium discoideum GN=dhkF PE=3 SV=1 816 912 7.0E-10
sp|A2XE31|ORR21_ORYSI Two-component response regulator ORR21 OS=Oryza sativa subsp. indica GN=RR21 PE=3 SV=1 973 1096 7.0E-10
sp|Q8H7S7|ORR21_ORYSJ Two-component response regulator ORR21 OS=Oryza sativa subsp. japonica GN=RR21 PE=2 SV=1 973 1096 7.0E-10
sp|Q940D0|ARR1_ARATH Two-component response regulator ARR1 OS=Arabidopsis thaliana GN=ARR1 PE=1 SV=2 973 1105 7.0E-10
sp|Q55E44|DHKE_DICDI Hybrid signal transduction histidine kinase E OS=Dictyostelium discoideum GN=dhkE PE=3 SV=1 810 879 8.0E-10
sp|Q54SP4|DHKD_DICDI Hybrid signal transduction histidine kinase D OS=Dictyostelium discoideum GN=dhkD PE=2 SV=1 812 890 8.0E-10
sp|A1KHB7|MPRA_MYCBP Response regulator MprA OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=mprA PE=3 SV=1 973 1091 8.0E-10
sp|Q7U0X4|MPRA_MYCBO Response regulator MprA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mprA PE=1 SV=1 973 1091 8.0E-10
sp|P0DMC6|RCSC_ECOLX Sensor histidine kinase RcsC OS=Escherichia coli GN=rcsC PE=1 SV=1 542 728 9.0E-10
sp|Q9XH58|ETR1_PELHO Ethylene receptor 1 OS=Pelargonium hortorum GN=ETR1 PE=2 SV=1 496 713 9.0E-10
sp|Q5AHA0|CHK1_CANAL Histidine protein kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHK1 PE=2 SV=1 512 714 1.0E-09
sp|P0DMC5|RCSC_ECOLI Sensor histidine kinase RcsC OS=Escherichia coli (strain K12) GN=rcsC PE=1 SV=1 542 728 1.0E-09
sp|Q7MD16|LUXQ_VIBVY Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain YJ016) GN=luxQ PE=3 SV=1 973 1090 1.0E-09
sp|Q45614|YYCG_BACSU Sensor histidine kinase YycG OS=Bacillus subtilis (strain 168) GN=yycG PE=1 SV=1 789 886 1.0E-09
sp|Q8Z333|ZRAR_SALTI Transcriptional regulatory protein ZraR OS=Salmonella typhi GN=zraR PE=3 SV=1 969 1104 1.0E-09
sp|P9WGM9|MPRA_MYCTU Response regulator MprA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mprA PE=1 SV=1 973 1093 1.0E-09
sp|P9WGM8|MPRA_MYCTO Response regulator MprA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mprA PE=3 SV=1 973 1093 1.0E-09
sp|A5U123|MPRA_MYCTA Response regulator MprA OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mprA PE=3 SV=1 973 1093 1.0E-09
sp|Q8FW53|DIVK_BRUSU Polar-differentiation response regulator DivK OS=Brucella suis biovar 1 (strain 1330) GN=divK PE=3 SV=1 975 1094 1.0E-09
sp|A9WYT1|DIVK_BRUSI Polar-differentiation response regulator DivK OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=divK PE=3 SV=1 975 1094 1.0E-09
sp|A5VUU3|DIVK_BRUO2 Polar-differentiation response regulator DivK OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=divK PE=3 SV=2 975 1094 1.0E-09
sp|Q8YC73|DIVK_BRUME Polar-differentiation response regulator DivK OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=divK PE=3 SV=1 975 1094 1.0E-09
sp|A9MBQ2|DIVK_BRUC2 Polar-differentiation response regulator DivK OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=divK PE=3 SV=1 975 1094 1.0E-09
sp|Q7BBW0|DIVK_BRUAB Polar-differentiation response regulator DivK OS=Brucella abortus biovar 1 (strain 9-941) GN=divK PE=1 SV=1 975 1094 1.0E-09
sp|Q2YKN1|DIVK_BRUA2 Polar-differentiation response regulator DivK OS=Brucella abortus (strain 2308) GN=divK PE=3 SV=1 975 1094 1.0E-09
sp|B2SB45|DIVK_BRUA1 Polar-differentiation response regulator DivK OS=Brucella abortus (strain S19) GN=divK PE=3 SV=1 975 1094 1.0E-09
sp|P25852|ZRAR_SALTY Transcriptional regulatory protein ZraR OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=zraR PE=1 SV=2 969 1104 1.0E-09
sp|Q5N6V8|ORR26_ORYSJ Two-component response regulator ORR26 OS=Oryza sativa subsp. japonica GN=RR26 PE=3 SV=2 973 1103 1.0E-09
sp|Q9ZWL6|ETR1_PASED Ethylene receptor OS=Passiflora edulis GN=ETR1 PE=2 SV=1 537 736 1.0E-09
sp|Q54W36|DHKH_DICDI Hybrid signal transduction histidine kinase H OS=Dictyostelium discoideum GN=dhkH PE=3 SV=1 814 893 1.0E-09
sp|O81122|ETR1_MALDO Ethylene receptor OS=Malus domestica GN=ETR1 PE=2 SV=1 496 721 1.0E-09
sp|A1A698|OHK4_ORYSJ Probable histidine kinase 4 OS=Oryza sativa subsp. japonica GN=HK4 PE=2 SV=1 969 1094 2.0E-09
sp|Q9C5U2|AHK2_ARATH Histidine kinase 2 OS=Arabidopsis thaliana GN=AHK2 PE=1 SV=1 974 1095 2.0E-09
sp|Q87GU5|LUXQ_VIBPA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=luxQ PE=3 SV=1 815 1091 2.0E-09
sp|Q8D5Z6|LUXQ_VIBVU Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain CMCP6) GN=luxQ PE=3 SV=1 973 1090 2.0E-09
sp|O34206|KINB_PSEAI Alginate biosynthesis sensor protein KinB OS=Pseudomonas aeruginosa GN=kinB PE=1 SV=1 816 885 2.0E-09
sp|A0QR01|SENX3_MYCS2 Signal-transduction histidine kinase senX3 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=senX3 PE=1 SV=1 812 884 2.0E-09
sp|Q7A0U4|SRRA_STAAW Transcriptional regulatory protein SrrA OS=Staphylococcus aureus (strain MW2) GN=srrA PE=3 SV=1 975 1081 2.0E-09
sp|Q9L524|SRRA_STAAU Transcriptional regulatory protein SrrA OS=Staphylococcus aureus GN=srrA PE=2 SV=2 975 1081 2.0E-09
sp|Q6G972|SRRA_STAAS Transcriptional regulatory protein SrrA OS=Staphylococcus aureus (strain MSSA476) GN=srrA PE=3 SV=2 975 1081 2.0E-09
sp|Q6GGK6|SRRA_STAAR Transcriptional regulatory protein SrrA OS=Staphylococcus aureus (strain MRSA252) GN=srrA PE=3 SV=2 975 1081 2.0E-09
sp|Q7A5H6|SRRA_STAAN Transcriptional regulatory protein SrrA OS=Staphylococcus aureus (strain N315) GN=srrA PE=1 SV=1 975 1081 2.0E-09
sp|Q7A2R6|SRRA_STAAM Transcriptional regulatory protein SrrA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=srrA PE=3 SV=1 975 1081 2.0E-09
sp|Q5HFT0|SRRA_STAAC Transcriptional regulatory protein SrrA OS=Staphylococcus aureus (strain COL) GN=srrA PE=2 SV=1 975 1081 2.0E-09
sp|Q2FY79|SRRA_STAA8 Transcriptional regulatory protein SrrA OS=Staphylococcus aureus (strain NCTC 8325) GN=srrA PE=3 SV=1 975 1081 2.0E-09
sp|P9WGK5|SENX3_MYCTU Sensor-like histidine kinase senX3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=senX3 PE=1 SV=1 812 928 2.0E-09
sp|P9WGK4|SENX3_MYCTO Sensor-like histidine kinase senX3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=senX3 PE=3 SV=1 812 928 2.0E-09
sp|P0A601|SENX3_MYCBO Sensor-like histidine kinase senX3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=senX3 PE=3 SV=1 812 928 2.0E-09
sp|Q6GGK7|SRRB_STAAR Sensor protein SrrB OS=Staphylococcus aureus (strain MRSA252) GN=srrB PE=3 SV=2 797 884 2.0E-09
sp|Q9L523|SRRB_STAAU Sensor protein SrrB OS=Staphylococcus aureus GN=srrB PE=2 SV=1 797 884 2.0E-09
sp|Q7A5H7|SRRB_STAAN Sensor protein SrrB OS=Staphylococcus aureus (strain N315) GN=srrB PE=1 SV=2 797 884 2.0E-09
sp|Q99TZ9|SRRB_STAAM Sensor protein SrrB OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=srrB PE=3 SV=2 797 884 2.0E-09
sp|Q8NWF3|SRRB_STAAW Sensor protein SrrB OS=Staphylococcus aureus (strain MW2) GN=srrB PE=3 SV=2 797 884 2.0E-09
sp|Q6G973|SRRB_STAAS Sensor protein SrrB OS=Staphylococcus aureus (strain MSSA476) GN=srrB PE=3 SV=2 797 884 2.0E-09
sp|Q5HFT1|SRRB_STAAC Sensor protein SrrB OS=Staphylococcus aureus (strain COL) GN=srrB PE=2 SV=1 797 884 2.0E-09
sp|Q2FY80|SRRB_STAA8 Sensor protein SrrB OS=Staphylococcus aureus (strain NCTC 8325) GN=srrB PE=3 SV=1 797 884 2.0E-09
sp|P37478|YYCF_BACSU Transcriptional regulatory protein YycF OS=Bacillus subtilis (strain 168) GN=yycF PE=1 SV=1 974 1102 2.0E-09
sp|O49230|ETR1_BRAOL Ethylene receptor 1 OS=Brassica oleracea GN=ETR1 PE=2 SV=1 496 713 2.0E-09
sp|Q54SK5|DHKM_DICDI Hybrid signal transduction histidine kinase M OS=Dictyostelium discoideum GN=dhkM PE=3 SV=1 810 911 3.0E-09
sp|Q93P00|CHEY_YEREN Chemotaxis protein CheY OS=Yersinia enterocolitica GN=cheY PE=3 SV=3 973 1097 3.0E-09
sp|P13792|PHOP_BACSU Alkaline phosphatase synthesis transcriptional regulatory protein PhoP OS=Bacillus subtilis (strain 168) GN=phoP PE=1 SV=4 974 1100 3.0E-09
sp|Q54Q69|DHKG_DICDI Hybrid signal transduction histidine kinase G OS=Dictyostelium discoideum GN=dhkG PE=3 SV=1 959 1090 4.0E-09
sp|Q54RP6|DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum GN=dhkL PE=3 SV=1 810 889 4.0E-09
sp|Q9CD68|MPRA_MYCLE Response regulator MprA OS=Mycobacterium leprae (strain TN) GN=mprA PE=3 SV=1 973 1093 4.0E-09
sp|A0PWB4|MPRA_MYCUA Response regulator MprA OS=Mycobacterium ulcerans (strain Agy99) GN=mprA PE=3 SV=1 973 1091 4.0E-09
sp|Q7A216|WALR_STAAW Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain MW2) GN=walR PE=3 SV=1 974 1080 5.0E-09
sp|Q9RDT5|WALR_STAAU Transcriptional regulatory protein WalR OS=Staphylococcus aureus GN=walR PE=1 SV=2 974 1080 5.0E-09
sp|A8YYU1|WALR_STAAT Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=walR PE=3 SV=2 974 1080 5.0E-09
sp|Q6GD72|WALR_STAAS Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain MSSA476) GN=walR PE=3 SV=2 974 1080 5.0E-09
sp|Q6GKS7|WALR_STAAR Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain MRSA252) GN=walR PE=3 SV=2 974 1080 5.0E-09
sp|Q7A8E1|WALR_STAAN Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain N315) GN=walR PE=1 SV=2 974 1080 5.0E-09
sp|Q99XF3|WALR_STAAM Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=walR PE=3 SV=2 974 1080 5.0E-09
sp|A6QD57|WALR_STAAE Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain Newman) GN=walR PE=3 SV=2 974 1080 5.0E-09
sp|Q5HJX7|WALR_STAAC Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain COL) GN=walR PE=3 SV=1 974 1080 5.0E-09
sp|Q2YUQ3|WALR_STAAB Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=walR PE=3 SV=2 974 1080 5.0E-09
sp|A5INQ9|WALR_STAA9 Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain JH9) GN=walR PE=3 SV=1 974 1080 5.0E-09
sp|Q2G2U6|WALR_STAA8 Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain NCTC 8325) GN=walR PE=1 SV=1 974 1080 5.0E-09
sp|Q2FKN8|WALR_STAA3 Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain USA300) GN=walR PE=3 SV=1 974 1080 5.0E-09
sp|A6TXG8|WALR_STAA2 Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain JH1) GN=walR PE=3 SV=1 974 1080 5.0E-09
sp|A7WWQ5|WALR_STAA1 Transcriptional regulatory protein WalR OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=walR PE=3 SV=2 974 1080 5.0E-09
sp|Q8CQK0|WALR_STAES Transcriptional regulatory protein WalR OS=Staphylococcus epidermidis (strain ATCC 12228) GN=walR PE=3 SV=1 974 1080 5.0E-09
sp|Q5HK18|WALR_STAEQ Transcriptional regulatory protein WalR OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=walR PE=3 SV=1 974 1080 5.0E-09
sp|Q9FAD7|CHEY_ENTCL Chemotaxis protein CheY OS=Enterobacter cloacae GN=cheY PE=3 SV=3 963 1097 6.0E-09
sp|P0AE69|CHEY_SHIFL Chemotaxis protein CheY OS=Shigella flexneri GN=cheY PE=3 SV=2 963 1097 7.0E-09
sp|P0AE67|CHEY_ECOLI Chemotaxis protein CheY OS=Escherichia coli (strain K12) GN=cheY PE=1 SV=2 963 1097 7.0E-09
sp|P0AE68|CHEY_ECO57 Chemotaxis protein CheY OS=Escherichia coli O157:H7 GN=cheY PE=3 SV=2 963 1097 7.0E-09
sp|Q8FGP6|CHEY_ECOL6 Chemotaxis protein CheY OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cheY PE=3 SV=3 963 1097 8.0E-09
sp|P14375|ZRAR_ECOLI Transcriptional regulatory protein ZraR OS=Escherichia coli (strain K12) GN=zraR PE=1 SV=2 970 1091 9.0E-09
sp|Q1D359|CHEB1_MYXXD Chemotaxis response regulator protein-glutamate methylesterase 1 OS=Myxococcus xanthus (strain DK 1622) GN=cheB1 PE=3 SV=1 971 1103 9.0E-09
sp|Q9SXL4|AHK1_ARATH Histidine kinase 1 OS=Arabidopsis thaliana GN=AHK1 PE=1 SV=2 964 1086 1.0E-08
sp|O82436|ETR1_CUCMN Ethylene receptor 1 OS=Cucumis melo var. cantalupensis GN=ETR1 PE=2 SV=1 537 721 1.0E-08
sp|P52931|SP0A_BACCI Stage 0 sporulation protein A (Fragment) OS=Bacillus circulans GN=spo0A PE=3 SV=1 972 1080 1.0E-08
sp|Q6GGZ4|ARLS_STAAR Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MRSA252) GN=arlS PE=3 SV=1 723 881 1.0E-08
sp|Q2YY04|ARLS_STAAB Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=arlS PE=3 SV=1 723 881 1.0E-08
sp|Q7A0W5|ARLS_STAAW Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MW2) GN=arlS PE=3 SV=1 723 881 1.0E-08
sp|Q6G9E7|ARLS_STAAS Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MSSA476) GN=arlS PE=3 SV=1 723 881 1.0E-08
sp|Q7A5N3|ARLS_STAAN Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain N315) GN=arlS PE=1 SV=1 723 881 1.0E-08
sp|Q7A2R7|ARLS_STAAM Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=arlS PE=3 SV=1 723 881 1.0E-08
sp|Q5HG05|ARLS_STAAC Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain COL) GN=arlS PE=3 SV=1 723 881 1.0E-08
sp|Q9KJN3|ARLS_STAA8 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain NCTC 8325) GN=arlS PE=1 SV=1 723 881 1.0E-08
sp|Q2FH24|ARLS_STAA3 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain USA300) GN=arlS PE=3 SV=1 723 881 1.0E-08
sp|P58363|ARCB_ECO57 Aerobic respiration control sensor protein ArcB OS=Escherichia coli O157:H7 GN=arcB PE=3 SV=1 811 883 1.0E-08
sp|P0AEC4|ARCB_SHIFL Aerobic respiration control sensor protein ArcB OS=Shigella flexneri GN=arcB PE=3 SV=1 811 883 1.0E-08
sp|P0AEC3|ARCB_ECOLI Aerobic respiration control sensor protein ArcB OS=Escherichia coli (strain K12) GN=arcB PE=1 SV=1 811 883 1.0E-08
sp|P0A2D5|CHEY_SALTY Chemotaxis protein CheY OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cheY PE=1 SV=2 963 1097 1.0E-08
sp|P0A2D6|CHEY_SALTI Chemotaxis protein CheY OS=Salmonella typhi GN=cheY PE=3 SV=2 963 1097 1.0E-08
sp|P35163|RESD_BACSU Transcriptional regulatory protein ResD OS=Bacillus subtilis (strain 168) GN=resD PE=3 SV=2 974 1081 1.0E-08
sp|A6X580|DIVK_OCHA4 Polar-differentiation response regulator DivK OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=divK PE=3 SV=1 975 1094 1.0E-08
sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 812 885 2.0E-08
sp|P9WGM3|PDTAR_MYCTU Probable transcriptional regulatory protein pdtaR OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pdtaR PE=1 SV=1 951 1080 2.0E-08
sp|P9WGM2|PDTAR_MYCTO Probable transcriptional regulatory protein pdtaR OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pdtaR PE=3 SV=1 951 1080 2.0E-08
sp|Q4LAJ9|WALR_STAHJ Transcriptional regulatory protein WalR OS=Staphylococcus haemolyticus (strain JCSC1435) GN=walR PE=3 SV=1 974 1080 2.0E-08
sp|P54883|SEX3_MYCLE Sensor-like histidine kinase senX3 OS=Mycobacterium leprae (strain TN) GN=senX3 PE=3 SV=1 812 884 2.0E-08
sp|A5A2P0|WALK_STASR Sensor protein kinase WalK (Fragment) OS=Staphylococcus sciuri subsp. rodentium GN=walK PE=3 SV=1 776 890 2.0E-08
sp|P26762|BVGS_BORBR Virulence sensor protein BvgS OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=bvgS PE=3 SV=2 813 1090 3.0E-08
sp|P40330|BVGS_BORPA Virulence sensor protein BvgS OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=bvgS PE=3 SV=2 813 1090 3.0E-08
sp|Q54SP4|DHKD_DICDI Hybrid signal transduction histidine kinase D OS=Dictyostelium discoideum GN=dhkD PE=2 SV=1 533 728 3.0E-08
sp|Q54W36|DHKH_DICDI Hybrid signal transduction histidine kinase H OS=Dictyostelium discoideum GN=dhkH PE=3 SV=1 973 1086 3.0E-08
sp|B0R4K1|CHEY_HALS3 Chemotaxis protein CheY OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=cheY PE=1 SV=1 974 1094 3.0E-08
sp|P94413|YCLJ_BACSU Uncharacterized transcriptional regulatory protein YclJ OS=Bacillus subtilis (strain 168) GN=yclJ PE=3 SV=1 973 1102 3.0E-08
sp|Q8X613|ZRAR_ECO57 Transcriptional regulatory protein ZraR OS=Escherichia coli O157:H7 GN=zraR PE=3 SV=1 970 1091 3.0E-08
sp|Q4A159|WALK_STAS1 Sensor protein kinase WalK OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=walK PE=3 SV=1 789 890 3.0E-08
sp|Q86AT9|DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum GN=dhkI-1 PE=3 SV=1 812 886 4.0E-08
sp|P16575|BVGS_BORPE Virulence sensor protein BvgS OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=bvgS PE=1 SV=3 813 1090 4.0E-08
sp|Q4LAJ8|WALK_STAHJ Sensor protein kinase WalK OS=Staphylococcus haemolyticus (strain JCSC1435) GN=walK PE=3 SV=1 766 890 4.0E-08
sp|P35164|RESE_BACSU Sensor histidine kinase ResE OS=Bacillus subtilis (strain 168) GN=resE PE=1 SV=1 812 886 4.0E-08
sp|P51586|YSO1_LEPBY Uncharacterized 14.6 kDa protein in sodA1 3'region OS=Leptolyngbya boryana PE=3 SV=1 971 1081 5.0E-08
sp|A1SMR4|CHEB_NOCSJ Chemotaxis response regulator protein-glutamate methylesterase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=cheB PE=3 SV=1 973 1080 5.0E-08
sp|Q8CU87|WALK_STAES Sensor protein kinase WalK OS=Staphylococcus epidermidis (strain ATCC 12228) GN=walK PE=1 SV=1 766 890 6.0E-08
sp|Q5HK19|WALK_STAEQ Sensor protein kinase WalK OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=walK PE=1 SV=1 766 890 6.0E-08
sp|Q9M8Y4|ARR22_ARATH Two-component response regulator ARR22 OS=Arabidopsis thaliana GN=ARR22 PE=2 SV=1 973 1095 6.0E-08
sp|Q4A160|WALR_STAS1 Transcriptional regulatory protein WalR OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=walR PE=3 SV=1 974 1080 6.0E-08
sp|Q53RH0|ERS1_ORYSJ Probable ethylene response sensor 1 OS=Oryza sativa subsp. japonica GN=ERS1 PE=2 SV=1 803 883 7.0E-08
sp|A2XL32|ERS1_ORYSI Probable ethylene response sensor 1 OS=Oryza sativa subsp. indica GN=ERS1 PE=2 SV=1 803 883 7.0E-08
sp|P87323|MCS4_SCHPO Response regulator mcs4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcs4 PE=3 SV=1 973 1088 7.0E-08
sp|P43501|PILH_PSEAE Protein PilH OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pilH PE=3 SV=1 974 1094 8.0E-08
sp|P94414|YCLK_BACSU Sensor histidine kinase YclK OS=Bacillus subtilis (strain 168) GN=yclK PE=3 SV=1 815 885 9.0E-08
sp|P06534|SP0A_BACSU Stage 0 sporulation protein A OS=Bacillus subtilis (strain 168) GN=spo0A PE=1 SV=1 972 1080 9.0E-08
sp|Q551X9|DHKF_DICDI Hybrid signal transduction histidine kinase F OS=Dictyostelium discoideum GN=dhkF PE=3 SV=1 514 755 1.0E-07
sp|Q9RQQ9|DIVL_CAUCR Sensor protein DivL OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=divL PE=1 SV=2 801 884 1.0E-07
sp|Q52969|Y1002_RHIME Uncharacterized sensor-like histidine kinase R01002 OS=Rhizobium meliloti (strain 1021) GN=R01002 PE=3 SV=2 548 719 1.0E-07
sp|P24072|CHEY_BACSU Chemotaxis protein CheY OS=Bacillus subtilis (strain 168) GN=cheY PE=1 SV=3 974 1093 1.0E-07
sp|O34638|YKOH_BACSU Sensor histidine kinase YkoH OS=Bacillus subtilis (strain 168) GN=ykoH PE=3 SV=1 806 882 1.0E-07
sp|P62647|CHEB_METMP Chemotaxis response regulator protein-glutamate methylesterase OS=Methanococcus maripaludis (strain S2 / LL) GN=cheB PE=3 SV=1 972 1098 1.0E-07
sp|Q01473|RCAC_MICDP Protein RcaC OS=Microchaete diplosiphon GN=rcaC PE=3 SV=2 973 1081 1.0E-07
sp|Q9KLK7|LUXQ_VIBCH Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=luxQ PE=1 SV=1 530 723 2.0E-07
sp|Q55E44|DHKE_DICDI Hybrid signal transduction histidine kinase E OS=Dictyostelium discoideum GN=dhkE PE=3 SV=1 535 729 2.0E-07
sp|P96126|CHEY_TREPA Chemotaxis protein CheY OS=Treponema pallidum (strain Nichols) GN=cheY PE=3 SV=1 960 1095 2.0E-07
sp|Q4L6C6|ARLR_STAHJ Response regulator ArlR OS=Staphylococcus haemolyticus (strain JCSC1435) GN=arlR PE=3 SV=1 975 1094 2.0E-07
sp|P52941|SP0A_MOOTA Stage 0 sporulation protein A homolog OS=Moorella thermoacetica (strain ATCC 39073) GN=spo0A PE=3 SV=2 973 1104 2.0E-07
sp|P23545|PHOR_BACSU Alkaline phosphatase synthesis sensor protein PhoR OS=Bacillus subtilis (strain 168) GN=phoR PE=1 SV=1 768 884 3.0E-07
sp|A7N6S2|CQSS_VIBCB CAI-1 autoinducer sensor kinase/phosphatase CqsS OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cqsS PE=1 SV=1 975 1080 3.0E-07
sp|Q9APD9|ZRAR_KLEOX Transcriptional regulatory protein ZraR OS=Klebsiella oxytoca GN=zraR PE=3 SV=1 975 1094 3.0E-07
sp|Q9RDT3|WALK_STAAU Sensor protein kinase WalK (Fragment) OS=Staphylococcus aureus GN=walK PE=1 SV=1 789 890 3.0E-07
sp|A1W0A5|CHEY_CAMJJ Chemotaxis protein CheY homolog OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=cheY PE=3 SV=1 973 1094 3.0E-07
sp|P0C635|CHEY_CAMJE Chemotaxis protein CheY homolog OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=cheY PE=3 SV=1 973 1094 3.0E-07
sp|A8FMH1|CHEY_CAMJ8 Chemotaxis protein CheY homolog OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=cheY PE=3 SV=1 973 1094 3.0E-07
sp|P94504|YVRH_BACSU Transcriptional regulatory protein YvrH OS=Bacillus subtilis (strain 168) GN=yvrH PE=3 SV=4 975 1081 4.0E-07
sp|P94439|YFIK_BACSU Uncharacterized transcriptional regulatory protein YfiK OS=Bacillus subtilis (strain 168) GN=yfiK PE=3 SV=1 973 1093 4.0E-07
sp|P28835|YCF27_PORAE Probable transcriptional regulator ycf27 OS=Porphyridium aerugineum GN=ycf27 PE=3 SV=1 974 1100 4.0E-07
sp|Q6GKS6|WALK_STAAR Sensor protein kinase WalK OS=Staphylococcus aureus (strain MRSA252) GN=walK PE=3 SV=1 789 890 5.0E-07
sp|Q7A215|WALK_STAAW Sensor protein kinase WalK OS=Staphylococcus aureus (strain MW2) GN=walK PE=3 SV=1 789 890 5.0E-07
sp|A8YYU2|WALK_STAAT Sensor protein kinase WalK OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=walK PE=3 SV=1 789 890 5.0E-07
sp|Q6GD71|WALK_STAAS Sensor protein kinase WalK OS=Staphylococcus aureus (strain MSSA476) GN=walK PE=3 SV=1 789 890 5.0E-07
sp|Q7A8E0|WALK_STAAN Sensor protein kinase WalK OS=Staphylococcus aureus (strain N315) GN=walK PE=1 SV=1 789 890 5.0E-07
sp|Q7A305|WALK_STAAM Sensor protein kinase WalK OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=walK PE=3 SV=1 789 890 5.0E-07
sp|Q5HJX6|WALK_STAAC Sensor protein kinase WalK OS=Staphylococcus aureus (strain COL) GN=walK PE=3 SV=1 789 890 5.0E-07
sp|Q2YUQ2|WALK_STAAB Sensor protein kinase WalK OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=walK PE=3 SV=1 789 890 5.0E-07
sp|A5INR0|WALK_STAA9 Sensor protein kinase WalK OS=Staphylococcus aureus (strain JH9) GN=walK PE=3 SV=1 789 890 5.0E-07
sp|Q2G2U4|WALK_STAA8 Sensor protein kinase WalK OS=Staphylococcus aureus (strain NCTC 8325) GN=walK PE=1 SV=1 789 890 5.0E-07
sp|Q2FKN7|WALK_STAA3 Sensor protein kinase WalK OS=Staphylococcus aureus (strain USA300) GN=walK PE=3 SV=1 789 890 5.0E-07
sp|A6TXG9|WALK_STAA2 Sensor protein kinase WalK OS=Staphylococcus aureus (strain JH1) GN=walK PE=3 SV=1 789 890 5.0E-07
sp|A7WWQ7|WALK_STAA1 Sensor protein kinase WalK OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=walK PE=3 SV=1 789 890 5.0E-07
sp|A6QD58|WALK_STAAE Sensor protein kinase WalK OS=Staphylococcus aureus (strain Newman) GN=walK PE=3 SV=1 789 890 5.0E-07
sp|P54302|LUXQ_VIBHA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio harveyi GN=luxQ PE=1 SV=1 973 1091 6.0E-07
sp|Q8L9Y3|ARR14_ARATH Two-component response regulator ARR14 OS=Arabidopsis thaliana GN=ARR14 PE=1 SV=2 973 1094 6.0E-07
sp|P71403|CHEY_HELPY Chemotaxis protein CheY homolog OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=cheY PE=1 SV=2 973 1094 6.0E-07
sp|Q49XM7|ARLR_STAS1 Response regulator ArlR OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=arlR PE=3 SV=1 974 1094 6.0E-07
sp|P58363|ARCB_ECO57 Aerobic respiration control sensor protein ArcB OS=Escherichia coli O157:H7 GN=arcB PE=3 SV=1 541 724 7.0E-07
sp|P0AEC4|ARCB_SHIFL Aerobic respiration control sensor protein ArcB OS=Shigella flexneri GN=arcB PE=3 SV=1 541 724 7.0E-07
sp|P0AEC3|ARCB_ECOLI Aerobic respiration control sensor protein ArcB OS=Escherichia coli (strain K12) GN=arcB PE=1 SV=1 541 724 7.0E-07
sp|P39663|SPHR_SYNE7 Alkaline phosphatase synthesis transcriptional regulatory protein SphR OS=Synechococcus elongatus (strain PCC 7942) GN=sphR PE=1 SV=1 974 1081 7.0E-07
sp|O74539|MAK3_SCHPO Peroxide stress-activated histidine kinase mak3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak3 PE=1 SV=1 974 1102 7.0E-07
sp|Q99U73|ARLR_STAAN Response regulator ArlR OS=Staphylococcus aureus (strain N315) GN=arlR PE=3 SV=2 974 1094 8.0E-07
sp|Q9ZM64|CHEY_HELPJ Chemotaxis protein CheY homolog OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=cheY PE=3 SV=1 973 1094 8.0E-07
sp|P0C001|ARLR_STAAW Response regulator ArlR OS=Staphylococcus aureus (strain MW2) GN=arlR PE=3 SV=1 974 1094 8.0E-07
sp|Q6G9E6|ARLR_STAAS Response regulator ArlR OS=Staphylococcus aureus (strain MSSA476) GN=arlR PE=3 SV=1 974 1094 8.0E-07
sp|Q6GGZ3|ARLR_STAAR Response regulator ArlR OS=Staphylococcus aureus (strain MRSA252) GN=arlR PE=3 SV=1 974 1094 8.0E-07
sp|P0C000|ARLR_STAAM Response regulator ArlR OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=arlR PE=3 SV=1 974 1094 8.0E-07
sp|Q5HG04|ARLR_STAAC Response regulator ArlR OS=Staphylococcus aureus (strain COL) GN=arlR PE=3 SV=1 974 1094 8.0E-07
sp|Q2YY03|ARLR_STAAB Response regulator ArlR OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=arlR PE=3 SV=1 974 1094 8.0E-07
sp|Q9KJN4|ARLR_STAA8 Response regulator ArlR OS=Staphylococcus aureus (strain NCTC 8325) GN=arlR PE=1 SV=1 974 1094 8.0E-07
sp|Q2FH23|ARLR_STAA3 Response regulator ArlR OS=Staphylococcus aureus (strain USA300) GN=arlR PE=3 SV=1 974 1094 8.0E-07
sp|O31671|KIND_BACSU Sporulation kinase D OS=Bacillus subtilis (strain 168) GN=kinD PE=1 SV=1 814 885 8.0E-07
sp|O82436|ETR1_CUCMN Ethylene receptor 1 OS=Cucumis melo var. cantalupensis GN=ETR1 PE=2 SV=1 785 885 9.0E-07
sp|P54662|DEGU_BREBE Transcriptional regulatory protein DegU OS=Brevibacillus brevis GN=degU PE=3 SV=1 966 1095 9.0E-07
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 540 728 1.0E-06
sp|C5M3F1|SRR1_CANTT Stress response regulator protein 1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=SRR1 PE=3 SV=1 974 1081 1.0E-06
sp|P52938|SP0A_PEPDI Stage 0 sporulation protein A homolog OS=Peptoclostridium difficile GN=spo0A PE=3 SV=1 972 1080 1.0E-06
sp|P45189|PHOB_HAEIN Phosphate regulon transcriptional regulatory protein PhoB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=phoB PE=3 SV=1 974 1097 1.0E-06
sp|Q38846|ERS1_ARATH Ethylene response sensor 1 OS=Arabidopsis thaliana GN=ERS1 PE=1 SV=1 519 713 1.0E-06
sp|Q95PI2|DHKC_DICDI Hybrid signal transduction histidine kinase C OS=Dictyostelium discoideum GN=dhkC PE=1 SV=1 941 1090 1.0E-06
sp|Q06065|ATOC_ECOLI Acetoacetate metabolism regulatory protein AtoC OS=Escherichia coli (strain K12) GN=atoC PE=3 SV=2 974 1080 1.0E-06
sp|P39486|DCTR_BACME Probable C4-dicarboxylate response regulator DctR OS=Bacillus megaterium GN=dctR PE=3 SV=1 975 1090 2.0E-06
sp|Q51455|CHEY_PSEAE Chemotaxis protein CheY OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cheY PE=3 SV=1 973 1097 2.0E-06
sp|P0A4I0|DLTR_STRA5 Transcriptional regulatory protein DltR OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltR PE=3 SV=1 973 1086 2.0E-06
sp|P0A4H9|DLTR_STRA3 Transcriptional regulatory protein DltR OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltR PE=3 SV=1 973 1086 2.0E-06
sp|O14283|PRR1_SCHPO Transcription factor prr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prr1 PE=1 SV=2 963 1081 2.0E-06
sp|P13800|DEGU_BACSU Transcriptional regulatory protein DegU OS=Bacillus subtilis (strain 168) GN=degU PE=1 SV=2 972 1095 2.0E-06
sp|Q0AYL3|CHEB1_SYNWW Chemotaxis response regulator protein-glutamate methylesterase 1 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=cheB1 PE=3 SV=1 972 1080 3.0E-06
sp|O69729|TCRY_MYCTU Probable sensor histidine kinase TcrY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=tcrY PE=1 SV=1 814 885 3.0E-06
sp|Q04942|AFSQ1_STRCO Transcriptional regulatory protein AfsQ1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=afsQ1 PE=1 SV=2 998 1098 3.0E-06
sp|Q9RC52|CITT_BACHD Transcriptional regulatory protein CitT OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=citT PE=3 SV=1 974 1098 3.0E-06
sp|Q47I43|CHEB1_DECAR Chemotaxis response regulator protein-glutamate methylesterase 1 OS=Dechloromonas aromatica (strain RCB) GN=cheB1 PE=3 SV=1 972 1080 3.0E-06
sp|P0CAW8|CTRA_CAUCR Cell cycle transcriptional regulator CtrA OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=ctrA PE=3 SV=1 973 1094 3.0E-06
sp|B8H358|CTRA_CAUCN Cell cycle transcriptional regulator CtrA OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=ctrA PE=3 SV=1 973 1094 3.0E-06
sp|Q9A5I5|PLED_CAUCR Response regulator PleD OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pleD PE=1 SV=1 974 1081 3.0E-06
sp|B8GZM2|PLED_CAUCN Response regulator PleD OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=pleD PE=1 SV=1 974 1081 3.0E-06
sp|P45709|CCDB_BACSU Protein CcdB OS=Bacillus subtilis (strain 168) GN=ccdB PE=3 SV=1 974 1093 4.0E-06
sp|P0A4H5|CHEY_LISMO Chemotaxis protein CheY OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cheY PE=3 SV=1 973 1082 4.0E-06
sp|P0A4H6|CHEY_LISIN Chemotaxis protein CheY OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=cheY PE=3 SV=1 973 1082 4.0E-06
sp|Q52969|Y1002_RHIME Uncharacterized sensor-like histidine kinase R01002 OS=Rhizobium meliloti (strain 1021) GN=R01002 PE=3 SV=2 811 910 5.0E-06
sp|P32040|Y851_SYNP2 Probable transcriptional regulatory protein SYNPCC7002_A0851 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=SYNPCC7002_A0851 PE=3 SV=2 974 1105 5.0E-06
sp|Q54SP4|DHKD_DICDI Hybrid signal transduction histidine kinase D OS=Dictyostelium discoideum GN=dhkD PE=2 SV=1 814 885 6.0E-06
sp|Q10WZ6|CHEB_TRIEI Chemotaxis response regulator protein-glutamate methylesterase OS=Trichodesmium erythraeum (strain IMS101) GN=cheB PE=3 SV=1 972 1080 6.0E-06
sp|O34903|YKOG_BACSU Uncharacterized transcriptional regulatory protein YkoG OS=Bacillus subtilis (strain 168) GN=ykoG PE=3 SV=1 975 1096 6.0E-06
sp|Q5JF95|CHEB_THEKO Chemotaxis response regulator protein-glutamate methylesterase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=cheB PE=3 SV=1 968 1080 6.0E-06
sp|Q6K9T0|ORR3_ORYSJ Two-component response regulator ORR3 OS=Oryza sativa subsp. japonica GN=RR3 PE=2 SV=1 975 1082 8.0E-06
sp|Q4GZK8|ORR3_ORYSI Two-component response regulator ORR3 OS=Oryza sativa subsp. indica GN=RR3 PE=2 SV=1 975 1082 8.0E-06
sp|Q23917|PDE2_DICDI 3',5'-cyclic-nucleotide phosphodiesterase regA OS=Dictyostelium discoideum GN=regA PE=1 SV=1 971 1101 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0000160 phosphorelay signal transduction system Yes
GO:0000155 phosphorelay sensor kinase activity Yes
GO:0007165 signal transduction Yes
GO:0004673 protein histidine kinase activity No
GO:0035556 intracellular signal transduction No
GO:0050794 regulation of cellular process No
GO:0016775 phosphotransferase activity, nitrogenous group as acceptor No
GO:0065007 biological regulation No
GO:0004672 protein kinase activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0008150 biological_process No
GO:0140299 small molecule sensor activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0009987 cellular process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0016301 kinase activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0050789 regulation of biological process No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4753
MRIGIREQLTAIVILAVLVALATISIPTWVYVHSFVVGVESDGLALTASLKASTIISEINMIQTICQTIATRVII
QQAMVNFYNDNFTSSEPFDGARTDLASAMSTSYRTGLLQARLYSRNSTGNPRGLLNVTGNGIGDQIIVLPGRLPD
GGAITLGDTEQGFPSVLYPNLTYEGLGYPNPYVPSTQAFVAIAFPGVRLNDNGGLLLGPLVVNETFALISLTVPI
RSLNISNFILGYVTLIASSSSFVNVQSSREGLSETGIVLVVGPSNPWNRFAATLSPSNSSYSPPRDAFARSPVHL
VLPPPRIERRPSRHGDLGSSFPLSEYPALMGLYYNRNPTPNNATALLSTRNEQGSLVAVGVARPQSTLVDWAVIV
EKTQEEAYLPIRTLRGILLGCVFGTACLIILLIFPCAHLSVRPVHRLKAATEESTCPPGYDDLDDHFDDESPSSG
GALSQRSKTGFLGSIRRKMTIKRRLITPAEVAGPRHVFKIPGKVPARKHHVTDELTELTQTFNDMSDELLKQYTS
LDEQVADRTRELEISKKAAEAANESKTLFIANLSHELKTPLNGIMGMAAICMEEDDVVRIKQSLKTLYKSGDLLL
HLLEDLLSFSKNQIGQNLSLEEKMFRLGDIRTQVLSIFDKQVRENRIAFTIAFQACEAYDSNSSSPDYQVWEKRM
ANGGPPHTGRIKDMCLWGDVQRLLQVIINLVSNSLKFTSPDGKVELRIRCVGELERHRDSKPSSLTRDGSSRATR
SRQRASASTTRSVSPRALHRTQMAEKGTALEINPAEPKALPYVQVGERAPTPPPANAKTFLFEFEVQDTGRGIPE
HMMGKIFEPFVQGDLGLSKKFGGTGLGLAICAQLAGLMGGSIRVKSTLGVGSTFTIQIPLKYMMDRPSSTASSSL
RDSIAGDEFPRNSLEQKTNNNTSSVLEDEQPRLVGLSAPFFAANPNSLPPPTKDQTAAIDKAMAKKQPVHGRLRV
LVADDNSTNVEVVSRMLKLEDVYDVTIAKDGQEAYDLVKANMEKEQHFDVIFMDIQMPNLDGLQSTRLIRQMGYA
APIVALTAFSEESNVRECRESGMNDFIAKPIRRPALKKVLAAILEEVETGRACPQ
Coding >Ophio5|4753
ATGCGTATCGGCATCCGGGAGCAGCTCACCGCGATAGTAATCTTGGCCGTCCTCGTTGCTCTCGCCACCATCTCT
ATCCCGACATGGGTCTACGTCCACAGCTTCGTCGTCGGCGTCGAGTCCGATGGCCTCGCCCTGACGGCGTCGCTC
AAGGCCTCGACGATCATATCCGAGATCAACATGATCCAGACCATCTGCCAGACCATCGCCACTCGCGTCATCATC
CAGCAGGCCATGGTCAACTTCTACAATGACAACTTCACCTCGTCTGAGCCATTCGACGGCGCCCGCACTGACCTG
GCCAGCGCTATGAGCACCTCGTATAGAACTGGTCTGCTCCAAGCCCGCCTATACTCGAGGAACTCGACCGGGAAC
CCCCGAGGCCTCCTCAACGTCACCGGCAATGGCATCGGCGACCAGATCATTGTGCTCCCCGGTCGACTCCCGGAC
GGCGGAGCCATCACTCTCGGCGATACTGAACAGGGCTTCCCCTCTGTTCTCTATCCCAACCTGACTTACGAAGGC
CTGGGCTATCCGAACCCCTACGTGCCCTCCACCCAGGCCTTTGTCGCAATTGCCTTCCCAGGCGTGAGGCTGAAC
GATAACGGCGGGCTCCTACTGGGACCCTTGGTGGTCAACGAGACCTTTGCTTTAATTTCCCTCACTGTTCCCATC
CGGTCGCTCAATATTTCCAACTTCATACTCGGTTATGTGACCCTGATAGCCTCCTCCTCGTCCTTTGTCAACGTC
CAATCATCTCGCGAAGGCCTGAGCGAGACGGGCATCGTCCTCGTCGTCGGTCCGAGCAACCCCTGGAACCGCTTT
GCTGCAACTCTTTCCCCCAGCAACAGCAGCTATTCCCCTCCCCGAGACGCCTTTGCACGCTCCCCCGTCCATCTT
GTTCTACCCCCGCCACGGATCGAAAGACGGCCGAGTCGGCACGGCGATCTCGGTTCTTCGTTTCCGCTATCCGAG
TATCCTGCCCTCATGGGCCTCTATTACAACCGGAATCCTACCCCAAACAACGCAACGGCCTTGTTGTCGACGAGA
AACGAGCAGGGGTCTCTGGTGGCCGTCGGCGTCGCCCGTCCTCAGTCCACGCTCGTCGACTGGGCCGTCATCGTC
GAGAAGACGCAGGAAGAGGCTTACCTGCCCATTCGAACTCTCAGGGGCATCCTTCTCGGTTGCGTCTTTGGCACC
GCCTGTCTCATCATTCTCTTGATTTTCCCCTGCGCCCATCTAAGTGTCCGACCCGTCCATCGGCTCAAGGCTGCC
ACGGAAGAGTCCACTTGTCCGCCTGGCTACGATGACCTGGACGACCACTTTGATGACGAGAGCCCGAGCTCGGGC
GGCGCCCTCAGTCAAAGGTCAAAGACGGGTTTCCTCGGCAGCATCCGGCGCAAGATGACGATCAAAAGAAGGCTG
ATCACCCCCGCCGAGGTCGCCGGGCCCCGCCACGTATTCAAGATTCCGGGCAAGGTTCCGGCTCGGAAGCACCAT
GTCACTGACGAGCTGACGGAGCTCACTCAGACCTTCAACGACATGTCAGACGAGCTGTTGAAGCAGTACACGTCT
TTGGACGAACAGGTGGCTGACCGGACCCGCGAGTTAGAGATTAGCAAGAAGGCGGCCGAGGCTGCCAACGAGAGC
AAGACGCTGTTCATTGCGAACCTGTCCCACGAGCTCAAGACGCCACTCAACGGCATCATGGGCATGGCGGCGATT
TGCATGGAGGAAGATGATGTCGTGCGCATCAAACAGTCTCTCAAGACATTGTACAAGTCGGGCGATCTCCTGTTG
CATCTCCTCGAAGATCTTCTCAGCTTCTCCAAGAACCAGATCGGCCAAAACCTCAGCCTCGAGGAGAAGATGTTC
CGCCTGGGTGACATCAGGACGCAGGTGCTGTCTATCTTCGACAAGCAGGTCAGGGAAAACCGCATCGCATTTACC
ATCGCCTTTCAGGCCTGTGAGGCGTACGATTCGAACTCGTCCAGTCCGGATTATCAGGTGTGGGAAAAAAGAATG
GCCAACGGCGGGCCTCCACACACGGGGCGTATCAAGGACATGTGCCTATGGGGAGACGTGCAGAGGCTGCTTCAG
GTCATCATCAACCTGGTCAGCAACAGCCTGAAGTTCACGTCACCGGACGGTAAGGTCGAGTTGAGGATACGATGT
GTGGGCGAGCTCGAGAGACACAGAGATAGCAAGCCCTCGTCCTTGACCAGGGATGGCTCGTCGAGAGCGACACGG
AGTCGACAAAGAGCTTCGGCGTCGACGACGCGATCCGTCAGCCCCAGGGCCCTTCATAGGACGCAAATGGCGGAA
AAGGGCACCGCTCTCGAGATCAACCCGGCCGAGCCCAAAGCGTTGCCCTATGTCCAAGTCGGCGAGAGGGCTCCC
ACACCGCCGCCGGCCAACGCCAAGACGTTTCTGTTTGAGTTTGAGGTGCAGGATACTGGTCGAGGCATCCCCGAG
CACATGATGGGCAAGATCTTCGAGCCCTTCGTACAGGGCGATCTCGGCCTCAGCAAGAAGTTTGGCGGCACCGGC
CTCGGGCTGGCCATCTGCGCTCAGCTCGCCGGGCTCATGGGCGGCTCCATCAGGGTGAAGAGCACTCTGGGCGTC
GGCTCTACCTTTACCATACAGATACCGCTCAAGTACATGATGGACCGACCTTCGAGCACCGCCTCCAGCAGCCTG
CGGGACTCGATTGCCGGCGACGAGTTCCCCCGCAACTCGCTGGAGCAAAAGACCAACAACAACACGTCGAGCGTG
CTCGAGGACGAGCAGCCGCGGCTGGTCGGCCTCAGCGCGCCCTTTTTTGCCGCCAACCCGAACTCACTGCCCCCT
CCCACCAAGGATCAGACGGCGGCCATCGACAAGGCCATGGCGAAAAAGCAGCCGGTCCACGGCAGGCTCCGGGTA
CTGGTGGCCGACGACAACTCGACCAACGTCGAGGTGGTCAGCAGGATGCTTAAGCTCGAGGATGTCTATGACGTG
ACCATCGCCAAGGACGGCCAGGAAGCTTATGACTTGGTCAAGGCCAACATGGAAAAGGAGCAGCACTTTGACGTC
ATCTTCATGGATATCCAGATGCCCAACCTAGACGGCTTGCAGTCGACGCGTCTCATCCGGCAGATGGGCTATGCT
GCGCCGATTGTGGCGCTCACGGCGTTTTCGGAAGAGAGCAACGTCCGCGAGTGTCGCGAGTCGGGTATGAATGAT
TTCATAGCGAAGCCGATTCGGAGACCAGCACTCAAGAAGGTGTTGGCGGCCATTCTCGAGGAGGTAGAGACGGGC
AGGGCTTGCCCGCAA
Transcript >Ophio5|4753
ATGCGTATCGGCATCCGGGAGCAGCTCACCGCGATAGTAATCTTGGCCGTCCTCGTTGCTCTCGCCACCATCTCT
ATCCCGACATGGGTCTACGTCCACAGCTTCGTCGTCGGCGTCGAGTCCGATGGCCTCGCCCTGACGGCGTCGCTC
AAGGCCTCGACGATCATATCCGAGATCAACATGATCCAGACCATCTGCCAGACCATCGCCACTCGCGTCATCATC
CAGCAGGCCATGGTCAACTTCTACAATGACAACTTCACCTCGTCTGAGCCATTCGACGGCGCCCGCACTGACCTG
GCCAGCGCTATGAGCACCTCGTATAGAACTGGTCTGCTCCAAGCCCGCCTATACTCGAGGAACTCGACCGGGAAC
CCCCGAGGCCTCCTCAACGTCACCGGCAATGGCATCGGCGACCAGATCATTGTGCTCCCCGGTCGACTCCCGGAC
GGCGGAGCCATCACTCTCGGCGATACTGAACAGGGCTTCCCCTCTGTTCTCTATCCCAACCTGACTTACGAAGGC
CTGGGCTATCCGAACCCCTACGTGCCCTCCACCCAGGCCTTTGTCGCAATTGCCTTCCCAGGCGTGAGGCTGAAC
GATAACGGCGGGCTCCTACTGGGACCCTTGGTGGTCAACGAGACCTTTGCTTTAATTTCCCTCACTGTTCCCATC
CGGTCGCTCAATATTTCCAACTTCATACTCGGTTATGTGACCCTGATAGCCTCCTCCTCGTCCTTTGTCAACGTC
CAATCATCTCGCGAAGGCCTGAGCGAGACGGGCATCGTCCTCGTCGTCGGTCCGAGCAACCCCTGGAACCGCTTT
GCTGCAACTCTTTCCCCCAGCAACAGCAGCTATTCCCCTCCCCGAGACGCCTTTGCACGCTCCCCCGTCCATCTT
GTTCTACCCCCGCCACGGATCGAAAGACGGCCGAGTCGGCACGGCGATCTCGGTTCTTCGTTTCCGCTATCCGAG
TATCCTGCCCTCATGGGCCTCTATTACAACCGGAATCCTACCCCAAACAACGCAACGGCCTTGTTGTCGACGAGA
AACGAGCAGGGGTCTCTGGTGGCCGTCGGCGTCGCCCGTCCTCAGTCCACGCTCGTCGACTGGGCCGTCATCGTC
GAGAAGACGCAGGAAGAGGCTTACCTGCCCATTCGAACTCTCAGGGGCATCCTTCTCGGTTGCGTCTTTGGCACC
GCCTGTCTCATCATTCTCTTGATTTTCCCCTGCGCCCATCTAAGTGTCCGACCCGTCCATCGGCTCAAGGCTGCC
ACGGAAGAGTCCACTTGTCCGCCTGGCTACGATGACCTGGACGACCACTTTGATGACGAGAGCCCGAGCTCGGGC
GGCGCCCTCAGTCAAAGGTCAAAGACGGGTTTCCTCGGCAGCATCCGGCGCAAGATGACGATCAAAAGAAGGCTG
ATCACCCCCGCCGAGGTCGCCGGGCCCCGCCACGTATTCAAGATTCCGGGCAAGGTTCCGGCTCGGAAGCACCAT
GTCACTGACGAGCTGACGGAGCTCACTCAGACCTTCAACGACATGTCAGACGAGCTGTTGAAGCAGTACACGTCT
TTGGACGAACAGGTGGCTGACCGGACCCGCGAGTTAGAGATTAGCAAGAAGGCGGCCGAGGCTGCCAACGAGAGC
AAGACGCTGTTCATTGCGAACCTGTCCCACGAGCTCAAGACGCCACTCAACGGCATCATGGGCATGGCGGCGATT
TGCATGGAGGAAGATGATGTCGTGCGCATCAAACAGTCTCTCAAGACATTGTACAAGTCGGGCGATCTCCTGTTG
CATCTCCTCGAAGATCTTCTCAGCTTCTCCAAGAACCAGATCGGCCAAAACCTCAGCCTCGAGGAGAAGATGTTC
CGCCTGGGTGACATCAGGACGCAGGTGCTGTCTATCTTCGACAAGCAGGTCAGGGAAAACCGCATCGCATTTACC
ATCGCCTTTCAGGCCTGTGAGGCGTACGATTCGAACTCGTCCAGTCCGGATTATCAGGTGTGGGAAAAAAGAATG
GCCAACGGCGGGCCTCCACACACGGGGCGTATCAAGGACATGTGCCTATGGGGAGACGTGCAGAGGCTGCTTCAG
GTCATCATCAACCTGGTCAGCAACAGCCTGAAGTTCACGTCACCGGACGGTAAGGTCGAGTTGAGGATACGATGT
GTGGGCGAGCTCGAGAGACACAGAGATAGCAAGCCCTCGTCCTTGACCAGGGATGGCTCGTCGAGAGCGACACGG
AGTCGACAAAGAGCTTCGGCGTCGACGACGCGATCCGTCAGCCCCAGGGCCCTTCATAGGACGCAAATGGCGGAA
AAGGGCACCGCTCTCGAGATCAACCCGGCCGAGCCCAAAGCGTTGCCCTATGTCCAAGTCGGCGAGAGGGCTCCC
ACACCGCCGCCGGCCAACGCCAAGACGTTTCTGTTTGAGTTTGAGGTGCAGGATACTGGTCGAGGCATCCCCGAG
CACATGATGGGCAAGATCTTCGAGCCCTTCGTACAGGGCGATCTCGGCCTCAGCAAGAAGTTTGGCGGCACCGGC
CTCGGGCTGGCCATCTGCGCTCAGCTCGCCGGGCTCATGGGCGGCTCCATCAGGGTGAAGAGCACTCTGGGCGTC
GGCTCTACCTTTACCATACAGATACCGCTCAAGTACATGATGGACCGACCTTCGAGCACCGCCTCCAGCAGCCTG
CGGGACTCGATTGCCGGCGACGAGTTCCCCCGCAACTCGCTGGAGCAAAAGACCAACAACAACACGTCGAGCGTG
CTCGAGGACGAGCAGCCGCGGCTGGTCGGCCTCAGCGCGCCCTTTTTTGCCGCCAACCCGAACTCACTGCCCCCT
CCCACCAAGGATCAGACGGCGGCCATCGACAAGGCCATGGCGAAAAAGCAGCCGGTCCACGGCAGGCTCCGGGTA
CTGGTGGCCGACGACAACTCGACCAACGTCGAGGTGGTCAGCAGGATGCTTAAGCTCGAGGATGTCTATGACGTG
ACCATCGCCAAGGACGGCCAGGAAGCTTATGACTTGGTCAAGGCCAACATGGAAAAGGAGCAGCACTTTGACGTC
ATCTTCATGGATATCCAGATGCCCAACCTAGACGGCTTGCAGTCGACGCGTCTCATCCGGCAGATGGGCTATGCT
GCGCCGATTGTGGCGCTCACGGCGTTTTCGGAAGAGAGCAACGTCCGCGAGTGTCGCGAGTCGGGTATGAATGAT
TTCATAGCGAAGCCGATTCGGAGACCAGCACTCAAGAAGGTGTTGGCGGCCATTCTCGAGGAGGTAGAGACGGGC
AGGGCTTGCCCGCAATAA
Gene >Ophio5|4753
ATGCGTATCGGCATCCGGGAGCAGCTCACCGCGATAGTAATCTTGGCCGTCCTCGTTGCTCTCGCCACCATCTCT
ATCCCGACATGGGTCTACGTCCACAGCTTCGTCGTCGGCGTCGAGTCCGATGGCCTCGCCCTGACGGCGTCGCTC
AAGGCCTCGACGATCATATCCGAGATCAACATGATCCAGACCATCTGCCAGACCATCGCCACTCGCGTCATCATC
CAGCAGGCCATGGTCAACTTCTACAATGACAACTTCACCTCGTCTGAGCCATTCGACGGCGCCCGCACTGACCTG
GCCAGCGCTATGAGCACCTCGTATAGAACTGGTCTGCTCCAAGCCCGCCTATACTCGAGGAACTCGACCGGGAAC
CCCCGAGGCCTCCTCAACGTCACCGGCAATGGCATCGGCGACCAGATCATTGTGCTCCCCGGTCGACTCCCGGAC
GGCGGAGCCATCACTCTCGGCGATACTGAACAGGGCTTCCCCTCTGTTCTCTATCCCAACCTGACTTACGAAGGC
CTGGGCTATCCGAACCCCTACGTGCCCTCCACCCAGGCCTTTGTCGCAATTGCCTTCCCAGGCGTGAGGCTGAAC
GATAACGGCGGGCTCCTACTGGGACCCTTGGTGGTCAACGAGACCTTTGCTTTAATTTCCCTCACTGTTCCCATC
CGGTCGCTCAATATTTCCAACTTCATACTCGGTTATGTGACCCTGATAGCCTCCTCCTCGTCCTTTGTCAACGTC
CAATCATCTCGCGAAGGCCTGAGCGAGACGGGCATCGTCCTCGTCGTCGGTCCGAGCAACCCCTGGAACCGCTTT
GCTGCAACTCTTTCCCCCAGCAACAGCAGCTATTCCCCTCCCCGAGACGCCTTTGCACGCTCCCCCGTCCATCTT
GTTCTACCCCCGCCACGGATCGAAAGACGGCCGAGTCGGCACGGCGATCTCGGTTCTTCGTTTCCGCTATCCGAG
TATCCTGCCCTCATGGGCCTCTATTACAACCGGAATCCTACCCCAAACAACGCAACGGCCTTGTTGTCGACGAGA
AACGAGCAGGGGTCTCTGGTGGCCGTCGGCGTCGCCCGTCCTCAGTCCACGCTCGTCGACTGGGCCGTCATCGTC
GAGAAGACGCAGGAAGAGGCTTACCTGCCCATTCGAACTCTCAGGGGCATCCTTCTCGGTTGCGTCTTTGGCACC
GCCTGTCTCATCATTCTCTTGATTTTCCCCTGCGCCCATCTAAGTGTCCGACCCGTCCATCGGCTCAAGGCTGCC
ACGGAAGAGTCCACTTGTCCGCCTGGCTACGATGACCTGGACGACCACTTTGATGACGAGAGCCCGAGCTCGGGC
GGCGCCCTCAGTCAAAGGTCAAAGACGGGTTTCCTCGGCAGCATCCGGCGCAAGATGACGATCAAAAGAAGGCTG
ATCACCCCCGCCGAGGTCGCCGGGCCCCGCCACGTATTCAAGATTCCGGGCAAGGTTCCGGCTCGGAAGCACCAT
GTCACTGACGAGCTGACGGAGCTCACTCAGACCTTCAACGACATGTCAGACGAGCTGTTGAAGCAGTACACGTCT
TTGGACGAACAGGTGGCTGACCGGACCCGCGAGTTAGAGATTAGCAAGAAGGCGGCCGAGGCTGCCAACGAGAGC
AAGACGCTGTTCATTGCGAACCTGTCCCACGAGCTCAAGACGCCACTCAACGGCATCATGGGCATGGCGGCGATT
TGCATGGAGGAAGATGATGTCGTGCGCATCAAACAGTCTCTCAAGACATTGTACAAGTCGGGTATGTGCCTCATG
GACCGGAGAGAGGGGGACGCAATGCTGACAGGGTTGAGTAGGCGATCTCCTGTTGCATCTCCTCGAAGATCTTCT
CAGCTTCTCCAAGAACCAGATCGGCCAAAACCTCAGCCTCGAGGAGAAGATGTTCCGCCTGGGTGACATCAGGAC
GCAGGTGCTGTCTATCTTCGACAAGCAGGTCAGGGAAAACCGCATCGCATTTACCATCGCCTTTCAGGCCTGTGA
GGCGTACGATTCGAACTCGTCCAGTCCGGATTATCAGGTGTGGGAAAAAAGAATGGCCAACGGCGGGCCTCCACA
CACGGGGCGTATCAAGGACATGTGCCTATGGGGAGACGTGCAGAGGCTGCTTCAGGTCATCATCAACCTGGTCAG
CAACAGCCTGAAGTTCACGTCACCGGACGGTAAGGTCGAGTTGAGGATACGATGTGTGGGCGAGCTCGAGAGACA
CAGAGATAGCAAGCCCTCGTCCTTGACCAGGGATGGCTCGTCGAGAGCGACACGGAGTCGACAAAGAGCTTCGGC
GTCGACGACGCGATCCGTCAGCCCCAGGGCCCTTCATAGGACGCAAATGGCGGAAAAGGGCACCGCTCTCGAGAT
CAACCCGGCCGAGCCCAAAGCGTTGCCCTATGTCCAAGTCGGCGAGAGGGCTCCCACACCGCCGCCGGCCAACGC
CAAGACGTTTCTGTTTGAGTTTGAGGTGCAGGATACTGGTCGAGGCATCCCCGAGCACATGATGGGCAAGATCTT
CGAGCCCTTCGTACAGGGCGATCTCGGCCTCAGCAAGAAGTTTGGCGGCACCGGCCTCGGGCTGGCCATCTGCGC
TCAGCTCGCCGGGCTCATGGGCGGCTCCATCAGGGTGAAGAGCACTCTGGGCGTCGGCTCTACCTTTACCATACA
GATACCGCTCAAGTACATGATGGACCGACCTTCGAGCACCGCCTCCAGCAGCCTGCGGGACTCGATTGCCGGCGA
CGAGTTCCCCCGCAACTCGCTGGAGCAAAAGACCAACAACAACACGTCGAGCGTGCTCGAGGACGAGCAGCCGCG
GCTGGTCGGCCTCAGCGCGCCCTTTTTTGCCGCCAACCCGAACTCACTGCCCCCTCCCACCAAGGATCAGACGGC
GGCCATCGACAAGGCCATGGCGAAAAAGCAGCCGGTCCACGGCAGGCTCCGGGTACTGGTGGCCGACGACAACTC
GACCAACGTCGAGGTGGTCAGCAGGATGCTTAAGCTCGAGGATGTCTATGACGTGACCATCGCCAAGGACGGCCA
GGAAGCTTATGACTTGGTCAAGGCCAACATGGAAAAGGAGCAGCACTTTGACGTCATCTTCATGGATATCCAGAT
GCCCAACCTAGACGGCTTGCAGTCGACGCGTCTCATCCGGCAGATGGGCTATGCTGCGCCGATTGTGGCGCTCAC
GGCGTTTTCGGAAGAGAGCAACGTCCGCGAGTGTCGCGAGTCGGGTATGAATGATTTCATAGCGAAGCCGATTCG
GAGACCAGCACTCAAGAAGGTGTTGGCGGCCATTCTCGAGGAGGTAGAGACGGGCAGGGCTTGCCCGCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail