Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4734
Gene name
Locationscaffold_379:11456..13623
Strand-
Gene length (bp)2167
Transcript length (bp)1977
Coding sequence length (bp)1974
Protein length (aa) 658

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00995 Sec1 Sec1 family 4.9E-127 31 643

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q63615|VP33A_RAT Vacuolar protein sorting-associated protein 33A OS=Rattus norvegicus GN=Vps33a PE=1 SV=1 12 648 8.0E-121
sp|Q9D2N9|VP33A_MOUSE Vacuolar protein sorting-associated protein 33A OS=Mus musculus GN=Vps33a PE=1 SV=2 12 648 5.0E-120
sp|Q96AX1|VP33A_HUMAN Vacuolar protein sorting-associated protein 33A OS=Homo sapiens GN=VPS33A PE=1 SV=1 12 648 1.0E-119
sp|Q94KJ7|VPS33_ARATH Vacuolar protein-sorting-associated protein 33 homolog OS=Arabidopsis thaliana GN=VPS33 PE=1 SV=1 10 648 6.0E-107
sp|Q9P7V6|VPS33_SCHPO Vacuolar protein sorting-associated protein 33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps33 PE=3 SV=1 12 646 1.0E-92
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q63615|VP33A_RAT Vacuolar protein sorting-associated protein 33A OS=Rattus norvegicus GN=Vps33a PE=1 SV=1 12 648 8.0E-121
sp|Q9D2N9|VP33A_MOUSE Vacuolar protein sorting-associated protein 33A OS=Mus musculus GN=Vps33a PE=1 SV=2 12 648 5.0E-120
sp|Q96AX1|VP33A_HUMAN Vacuolar protein sorting-associated protein 33A OS=Homo sapiens GN=VPS33A PE=1 SV=1 12 648 1.0E-119
sp|Q94KJ7|VPS33_ARATH Vacuolar protein-sorting-associated protein 33 homolog OS=Arabidopsis thaliana GN=VPS33 PE=1 SV=1 10 648 6.0E-107
sp|Q9P7V6|VPS33_SCHPO Vacuolar protein sorting-associated protein 33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps33 PE=3 SV=1 12 646 1.0E-92
sp|Q2HJ18|VP33B_BOVIN Vacuolar protein sorting-associated protein 33B OS=Bos taurus GN=VPS33B PE=2 SV=1 16 647 2.0E-80
sp|Q9Y1I2|VP33A_DROME Vacuolar protein sorting-associated protein 33A OS=Drosophila melanogaster GN=car PE=1 SV=1 16 646 2.0E-79
sp|P59016|VP33B_MOUSE Vacuolar protein sorting-associated protein 33B OS=Mus musculus GN=Vps33b PE=1 SV=1 16 650 4.0E-79
sp|Q63616|VP33B_RAT Vacuolar protein sorting-associated protein 33B OS=Rattus norvegicus GN=Vps33b PE=2 SV=1 16 650 5.0E-79
sp|Q9H267|VP33B_HUMAN Vacuolar protein sorting-associated protein 33B OS=Homo sapiens GN=VPS33B PE=1 SV=2 16 647 9.0E-79
sp|Q58EN8|VP33B_DANRE Vacuolar protein sorting-associated protein 33B OS=Danio rerio GN=vps33b PE=2 SV=1 16 648 2.0E-77
sp|P20795|VPS33_YEAST Vacuolar protein sorting-associated protein 33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS33 PE=1 SV=1 181 644 6.0E-31
sp|P34260|VP33A_CAEEL Vacuolar protein sorting-associated protein 33A OS=Caenorhabditis elegans GN=vps-33.1 PE=1 SV=4 16 643 3.0E-30
sp|Q6R748|STXB1_CHICK Syntaxin-binding protein 1 OS=Gallus gallus GN=STXBP1 PE=2 SV=1 133 458 1.0E-18
sp|Q15833|STXB2_HUMAN Syntaxin-binding protein 2 OS=Homo sapiens GN=STXBP2 PE=1 SV=2 133 458 2.0E-18
sp|P61763|STXB1_BOVIN Syntaxin-binding protein 1 OS=Bos taurus GN=STXBP1 PE=1 SV=1 133 443 3.0E-18
sp|P61764|STXB1_HUMAN Syntaxin-binding protein 1 OS=Homo sapiens GN=STXBP1 PE=1 SV=1 133 443 3.0E-18
sp|Q5R6D2|STXB1_PONAB Syntaxin-binding protein 1 OS=Pongo abelii GN=STXBP1 PE=2 SV=1 133 443 3.0E-18
sp|P61765|STXB1_RAT Syntaxin-binding protein 1 OS=Rattus norvegicus GN=Stxbp1 PE=1 SV=1 133 443 3.0E-18
sp|O08599|STXB1_MOUSE Syntaxin-binding protein 1 OS=Mus musculus GN=Stxbp1 PE=1 SV=2 133 443 3.0E-18
sp|Q28288|STXB2_CANLF Syntaxin-binding protein 2 OS=Canis lupus familiaris GN=STXBP2 PE=2 SV=1 133 458 4.0E-18
sp|Q64324|STXB2_MOUSE Syntaxin-binding protein 2 OS=Mus musculus GN=Stxbp2 PE=1 SV=1 133 643 5.0E-18
sp|Q62753|STXB2_RAT Syntaxin-binding protein 2 OS=Rattus norvegicus GN=Stxbp2 PE=2 SV=1 133 458 5.0E-17
sp|P34815|UNC18_CAEEL Putative acetylcholine regulator unc-18 OS=Caenorhabditis elegans GN=unc-18 PE=2 SV=3 133 393 3.0E-14
sp|Q07327|ROP_DROME Protein ROP OS=Drosophila melanogaster GN=Rop PE=2 SV=2 133 443 5.0E-14
sp|Q09805|VPS45_SCHPO Vacuolar protein sorting-associated protein 45 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps45 PE=3 SV=1 233 443 2.0E-13
sp|O49048|VPS45_ARATH Vacuolar protein sorting-associated protein 45 homolog OS=Arabidopsis thaliana GN=VPS45 PE=1 SV=2 193 423 2.0E-11
sp|Q54GE3|VPS45_DICDI Vacuolar protein sorting-associated protein 45 OS=Dictyostelium discoideum GN=vps45 PE=1 SV=1 233 423 3.0E-11
sp|Q60770|STXB3_MOUSE Syntaxin-binding protein 3 OS=Mus musculus GN=Stxbp3 PE=1 SV=1 136 397 1.0E-09
sp|Q9SZ77|SEC1B_ARATH Protein transport Sec1b OS=Arabidopsis thaliana GN=SEC1B PE=2 SV=3 226 636 2.0E-09
sp|O08700|VPS45_RAT Vacuolar protein sorting-associated protein 45 OS=Rattus norvegicus GN=Vps45 PE=1 SV=1 233 422 6.0E-09
sp|P97390|VPS45_MOUSE Vacuolar protein sorting-associated protein 45 OS=Mus musculus GN=Vps45 PE=1 SV=1 233 422 7.0E-09
sp|Q54QC8|SEC1_DICDI Protein transport protein sec1 OS=Dictyostelium discoideum GN=sec1 PE=3 SV=1 223 643 7.0E-09
sp|Q9C5X3|KEULE_ARATH SNARE-interacting protein KEULE OS=Arabidopsis thaliana GN=KEU PE=1 SV=2 226 635 9.0E-09
sp|Q9C5P7|SEC1A_ARATH Protein transport Sec1a OS=Arabidopsis thaliana GN=SEC1A PE=2 SV=3 226 635 4.0E-08
sp|P38932|VPS45_YEAST Vacuolar protein sorting-associated protein 45 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS45 PE=1 SV=2 209 422 7.0E-08
sp|Q9NRW7|VPS45_HUMAN Vacuolar protein sorting-associated protein 45 OS=Homo sapiens GN=VPS45 PE=1 SV=1 233 405 6.0E-07
sp|Q7XWP3|SEC1A_ORYSJ Probable protein transport Sec1a OS=Oryza sativa subsp. japonica GN=Os04g0252400 PE=3 SV=2 226 425 1.0E-06
sp|O94590|SEC1_SCHPO Protein transport protein sec1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec1 PE=3 SV=1 223 428 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016192 vesicle-mediated transport Yes
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 597 619 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4734
MAPRTEFSSEQVRGKARKDFLYLLEGVRGKKNLVFDRSLVGPIGTVVKVATLQEYGVDKFFILENDNVDSSQHNI
VFVARGECGRHPEAIAAQMKRVQRESQTTHDFHIFWVPRRTLVADQLLEEAGVLGDVSISELPLFFFPLERDVLS
LELDDSFRDLYLSKDVTPNYLLARALMQVQQNHGLFPRIVGKGDNAKRVADLLCRLRQEALAGENASDVGKTGLS
PSTSNESVIIIDREVDFVTPLLTQLTYEGLIDEVFGIQNNQAKVDTAVVGAPAQSSAATSQSRKRTIQLDSSDKL
YEQLRDANFAIVGGLLNKVARRLQQVHSDYESRHKTKTLAELKEFVGRLPGYQQEHQSARIHTGLAEDIIKHTRS
DQFKGLLEVQQNLAAGADPSSQFDAIEELIARDTPLRETLRLLCIYSCISGGVKPKEYDNFRRLILHGYGYQHIL
TLNNLEKLQLFLSRASPLAGVIPLSSSAPATGSKTNYAFLRKQLRLIVDEVQEDNPNDIAYVYSGYAPLSIRLVQ
CVLQKQQLLSVTKGNGVSGADVSVSSGTATQGWHGFDEAVKHVRGPTFYEIQKGEDKAVKARALLAGSGHKQTVF
VVLVGGITFTEIAALRFLAKQEEDRRNIVICTTSIISGNRMMDAAIERESFAPQGGGG
Coding >Ophio5|4734
ATGGCGCCTCGCACCGAGTTCAGCTCTGAGCAGGTCCGTGGTAAGGCTCGCAAGGACTTCCTGTATCTGCTCGAG
GGTGTCCGCGGCAAGAAGAACCTCGTGTTCGATCGCAGCCTCGTCGGACCCATCGGAACCGTCGTCAAGGTCGCG
ACGCTGCAGGAGTACGGCGTCGACAAGTTCTTCATCCTCGAAAACGACAATGTCGACTCCAGCCAGCACAATATC
GTCTTTGTCGCCAGGGGCGAGTGTGGCCGCCATCCCGAGGCTATAGCAGCCCAGATGAAGCGGGTGCAGCGCGAA
AGCCAAACCACCCATGACTTCCACATCTTCTGGGTCCCGCGCCGGACTCTGGTCGCCGACCAGCTGCTCGAGGAG
GCTGGTGTGCTCGGTGACGTCAGCATTTCCGAGCTTCCCTTATTCTTCTTCCCTCTTGAAAGGGACGTCCTGTCT
CTGGAGCTCGACGATTCCTTTCGCGACCTCTACCTGTCCAAGGACGTCACGCCCAACTACCTGTTGGCCCGGGCC
CTGATGCAAGTGCAGCAGAATCATGGCCTTTTCCCTCGCATCGTCGGCAAGGGCGACAACGCGAAGCGGGTGGCC
GACCTGCTCTGCCGTCTGCGCCAGGAGGCACTCGCCGGCGAGAACGCGTCAGACGTGGGCAAGACGGGTCTTTCG
CCGAGCACATCCAACGAGAGCGTCATCATCATCGACCGCGAAGTCGACTTTGTCACTCCGCTGCTTACACAGCTG
ACGTACGAGGGCCTCATTGATGAAGTCTTTGGCATCCAGAACAATCAGGCAAAGGTCGATACCGCAGTCGTTGGC
GCACCGGCGCAGTCATCGGCCGCGACGTCGCAGAGCCGTAAAAGGACGATTCAGCTCGACTCGAGCGACAAGCTG
TACGAGCAGCTGCGAGATGCCAACTTTGCCATCGTTGGAGGACTGCTGAACAAGGTCGCCCGCCGACTGCAGCAA
GTTCACAGCGACTACGAGAGCAGGCACAAGACCAAGACGCTGGCCGAGCTCAAGGAGTTTGTCGGACGCTTGCCG
GGCTACCAGCAAGAGCATCAGAGCGCCAGGATACACACGGGGCTTGCCGAAGACATCATCAAGCACACCCGCTCT
GATCAGTTCAAGGGCCTGCTTGAGGTTCAGCAGAACCTCGCTGCCGGCGCGGACCCCTCGTCCCAGTTTGACGCC
ATAGAGGAGCTCATCGCGCGCGACACGCCGTTGCGAGAGACGCTCAGGCTGCTGTGCATCTACTCTTGCATCTCG
GGAGGAGTGAAGCCTAAGGAGTACGATAATTTCCGACGGTTGATTCTGCACGGCTACGGCTACCAGCACATTCTG
ACGCTTAACAACCTTGAGAAGCTTCAGCTCTTCCTGTCGCGCGCCTCGCCGCTCGCCGGCGTGATACCCCTGTCA
AGTAGTGCTCCCGCGACAGGGAGTAAAACCAACTACGCATTTCTGCGGAAGCAGCTCCGGCTCATCGTGGACGAG
GTGCAGGAGGATAATCCCAACGACATAGCATACGTGTACAGCGGATACGCGCCGCTTTCAATTCGGCTCGTGCAG
TGCGTGCTGCAAAAGCAACAACTGCTGTCCGTCACCAAGGGCAACGGCGTCTCCGGCGCGGACGTCAGTGTCTCG
TCCGGCACGGCCACACAGGGCTGGCACGGCTTCGACGAGGCTGTGAAGCACGTCCGCGGACCGACCTTTTATGAG
ATCCAGAAGGGCGAAGACAAGGCCGTCAAGGCAAGAGCCTTACTCGCGGGTAGTGGCCACAAGCAAACCGTCTTC
GTCGTCTTAGTGGGCGGCATCACCTTTACGGAGATTGCGGCGCTTCGATTCCTGGCTAAGCAGGAAGAGGACCGC
CGAAACATCGTCATCTGCACCACATCCATCATCAGCGGTAACCGGATGATGGACGCGGCCATCGAGAGAGAGTCG
TTTGCGCCGCAGGGAGGCGGTGGA
Transcript >Ophio5|4734
ATGGCGCCTCGCACCGAGTTCAGCTCTGAGCAGGTCCGTGGTAAGGCTCGCAAGGACTTCCTGTATCTGCTCGAG
GGTGTCCGCGGCAAGAAGAACCTCGTGTTCGATCGCAGCCTCGTCGGACCCATCGGAACCGTCGTCAAGGTCGCG
ACGCTGCAGGAGTACGGCGTCGACAAGTTCTTCATCCTCGAAAACGACAATGTCGACTCCAGCCAGCACAATATC
GTCTTTGTCGCCAGGGGCGAGTGTGGCCGCCATCCCGAGGCTATAGCAGCCCAGATGAAGCGGGTGCAGCGCGAA
AGCCAAACCACCCATGACTTCCACATCTTCTGGGTCCCGCGCCGGACTCTGGTCGCCGACCAGCTGCTCGAGGAG
GCTGGTGTGCTCGGTGACGTCAGCATTTCCGAGCTTCCCTTATTCTTCTTCCCTCTTGAAAGGGACGTCCTGTCT
CTGGAGCTCGACGATTCCTTTCGCGACCTCTACCTGTCCAAGGACGTCACGCCCAACTACCTGTTGGCCCGGGCC
CTGATGCAAGTGCAGCAGAATCATGGCCTTTTCCCTCGCATCGTCGGCAAGGGCGACAACGCGAAGCGGGTGGCC
GACCTGCTCTGCCGTCTGCGCCAGGAGGCACTCGCCGGCGAGAACGCGTCAGACGTGGGCAAGACGGGTCTTTCG
CCGAGCACATCCAACGAGAGCGTCATCATCATCGACCGCGAAGTCGACTTTGTCACTCCGCTGCTTACACAGCTG
ACGTACGAGGGCCTCATTGATGAAGTCTTTGGCATCCAGAACAATCAGGCAAAGGTCGATACCGCAGTCGTTGGC
GCACCGGCGCAGTCATCGGCCGCGACGTCGCAGAGCCGTAAAAGGACGATTCAGCTCGACTCGAGCGACAAGCTG
TACGAGCAGCTGCGAGATGCCAACTTTGCCATCGTTGGAGGACTGCTGAACAAGGTCGCCCGCCGACTGCAGCAA
GTTCACAGCGACTACGAGAGCAGGCACAAGACCAAGACGCTGGCCGAGCTCAAGGAGTTTGTCGGACGCTTGCCG
GGCTACCAGCAAGAGCATCAGAGCGCCAGGATACACACGGGGCTTGCCGAAGACATCATCAAGCACACCCGCTCT
GATCAGTTCAAGGGCCTGCTTGAGGTTCAGCAGAACCTCGCTGCCGGCGCGGACCCCTCGTCCCAGTTTGACGCC
ATAGAGGAGCTCATCGCGCGCGACACGCCGTTGCGAGAGACGCTCAGGCTGCTGTGCATCTACTCTTGCATCTCG
GGAGGAGTGAAGCCTAAGGAGTACGATAATTTCCGACGGTTGATTCTGCACGGCTACGGCTACCAGCACATTCTG
ACGCTTAACAACCTTGAGAAGCTTCAGCTCTTCCTGTCGCGCGCCTCGCCGCTCGCCGGCGTGATACCCCTGTCA
AGTAGTGCTCCCGCGACAGGGAGTAAAACCAACTACGCATTTCTGCGGAAGCAGCTCCGGCTCATCGTGGACGAG
GTGCAGGAGGATAATCCCAACGACATAGCATACGTGTACAGCGGATACGCGCCGCTTTCAATTCGGCTCGTGCAG
TGCGTGCTGCAAAAGCAACAACTGCTGTCCGTCACCAAGGGCAACGGCGTCTCCGGCGCGGACGTCAGTGTCTCG
TCCGGCACGGCCACACAGGGCTGGCACGGCTTCGACGAGGCTGTGAAGCACGTCCGCGGACCGACCTTTTATGAG
ATCCAGAAGGGCGAAGACAAGGCCGTCAAGGCAAGAGCCTTACTCGCGGGTAGTGGCCACAAGCAAACCGTCTTC
GTCGTCTTAGTGGGCGGCATCACCTTTACGGAGATTGCGGCGCTTCGATTCCTGGCTAAGCAGGAAGAGGACCGC
CGAAACATCGTCATCTGCACCACATCCATCATCAGCGGTAACCGGATGATGGACGCGGCCATCGAGAGAGAGTCG
TTTGCGCCGCAGGGAGGCGGTGGATAG
Gene >Ophio5|4734
ATGGCGCCTCGCACCGAGTTCAGCTCTGAGCAGGTCCGTGGTAAGGCTCGCAAGGACTTCCTGTATCTGCTCGAG
GGTGTAAGTGAGGCTCACGGCAAAGGTCAAATCTTGCAGAGCCCAGCCTGCTGATCACTCCAGCTCGCAGGTCCG
CGGCAAGAAGAACCTCGTGTTCGATCGCAGCCTCGTCGGACCCATCGGAACCGTCGTCAAGGTCGCGACGCTGCA
GGAGTACGGCGTCGACAAGTTCTTCATCCTCGAAAACGACAATGTCGACTCCAGCCAGCACAATATCGTCTTTGT
CGCCAGGGGCGAGTGTGGCCGCCATCCCGAGGCTATAGCAGGTATGCCGGCCTCGGAGTCTTTTGACTAGGGAAA
TGCGCCTCGGGCTGACAAGTTTTGCTCTCCTCAGCCCAGATGAAGCGGGTGCAGCGCGAAAGCCAAACCACCCAT
GACTTCCACATCTTCTGGGTCCCGCGCCGGACTCTGGTCGCCGACCAGCTGCTCGAGGAGGCTGGTGTGCTCGGT
GACGTCAGCATTTCCGAGCTTCCCTTATTCTTCTTCCCTCTTGAAAGGGACGTCCTGTCTCTGGAGCTCGACGAT
TCCTTTCGCGACCTCTACCTGTCCAAGGACGTCACGCCCAACTACCTGTTGGCCCGGGCCCTGATGCAAGTGCAG
CAGAATCATGGCCTTTTCCCTCGCATCGTCGGCAAGGGCGACAACGCGAAGCGGGTGGCCGACCTGCTCTGCCGT
CTGCGCCAGGAGGCACTCGCCGGCGAGAACGCGTCAGACGTGGGCAAGACGGGTCTTTCGCCGAGCACATCCAAC
GAGAGCGTCATCATCATCGACCGCGAAGTCGACTTTGTCACTCCGCTGCTTACACAGCTGACGTACGAGGGCCTC
ATTGATGAAGTCTTTGGCATCCAGAACAATCAGGCAAAGGTCGATACCGCAGTCGTTGGCGCACCGGCGCAGTCA
TCGGCCGCGACGTCGCAGAGCCGTAAAAGGACGATTCAGCTCGACTCGAGCGACAAGCTGTACGAGCAGCTGCGA
GATGCCAACTTTGCCATCGTTGGAGGACTGCTGAACAAGGTCGCCCGCCGACTGCAGCAAGTTCACAGCGACTAC
GAGAGCAGGCACAAGACCAAGACGCTGGCCGAGCTCAAGGAGTTTGTCGGACGCTTGCCGGGCTACCAGCAAGAG
CATCAGAGCGCCAGGATACACACGGGGCTTGCCGAAGACATCATCAAGCACACCCGCTCTGATCAGTTCAAGGGC
CTGCTTGAGGTTCAGCAGAACCTCGCTGCCGGCGCGGACCCCTCGTCCCAGTTTGACGCCATAGAGGAGCTCATC
GCGCGCGACACGCCGTTGCGAGAGACGCTCAGGCTGCTGTGCATCTACTCTTGCATCTCGGGAGGAGTGAAGCCT
AAGGAGTACGATAATTTCCGACGGTTGATTCTGCACGGCTACGGCTACCAGCACATTCTGACGCTTAACAACCTT
GAGAAGCTTCAGCTCTTCCTGTCGCGCGCCTCGCCGCTCGCCGGCGTGATACCCCTGTCAAGTAGTGCTCCCGCG
ACAGGGAGTAAAACCAACTACGCATTTCTGCGGAAGCAGCTCCGGCTCATCGTGGACGAGGTGCAGGAGGATAAT
CCCAACGACATAGCATACGTGTACAGCGGATACGCGCCGCTTTCAATTCGGCTCGTGCAGTGCGTGCTGCAAAAG
CAACAACTGCTGTCCGTCACCAAGGGCAACGGCGTCTCCGGCGCGGACGTCAGTGTCTCGTCCGGCACGGCCACA
CAGGGCTGGCACGGCTTCGACGAGGCTGTGAAGCACGTCCGCGGACCGACCTTTTATGAGATCCAGAAGGGCGAA
GACAAGGCCGTCAAGGCAAGAGCCTTACTCGCGGGTAGTGGCCACAAGCAAACCGTCTTCGTCGTCTTAGTGGGC
GGCATCACCTTTACGGAGATTGCGGCGCTTCGATTCCTGGCTAAGCAGGAAGAGGGTAAGCAGCCCACGCTCCCA
GCCATCGGTACCACAGTCTGACCAGAAGCGCACAGACCGCCGAAACATCGTCATCTGCACCACATCCATCATCAG
CGGTAACCGGATGATGGACGCGGCCATCGAGAGAGAGTCGTTTGCGCCGCAGGGAGGCGGTGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail