Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4723
Gene name
Locationscaffold_378:3385..5166
Strand-
Gene length (bp)1781
Transcript length (bp)1713
Coding sequence length (bp)1710
Protein length (aa) 570

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00565 SNase Staphylococcal nuclease homologue 2.2E-05 33 140
PF00565 SNase Staphylococcal nuclease homologue 4.6E-13 198 304
PF00565 SNase Staphylococcal nuclease homologue 2.8E-16 342 451
PF00565 SNase Staphylococcal nuclease homologue 7.1E-05 510 568

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7U7|SND1_SCHPO Staphylococcal nuclease domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snd1 PE=1 SV=1 1 568 4.0E-123
sp|Q863B3|SND1_BOVIN Staphylococcal nuclease domain-containing protein 1 OS=Bos taurus GN=SND1 PE=1 SV=1 7 568 2.0E-90
sp|Q5REU4|SND1_PONAB Staphylococcal nuclease domain-containing protein 1 OS=Pongo abelii GN=SND1 PE=2 SV=1 7 568 2.0E-90
sp|Q7KZF4|SND1_HUMAN Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens GN=SND1 PE=1 SV=1 7 568 3.0E-90
sp|Q78PY7|SND1_MOUSE Staphylococcal nuclease domain-containing protein 1 OS=Mus musculus GN=Snd1 PE=1 SV=1 7 568 9.0E-90
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7U7|SND1_SCHPO Staphylococcal nuclease domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snd1 PE=1 SV=1 1 568 4.0E-123
sp|Q863B3|SND1_BOVIN Staphylococcal nuclease domain-containing protein 1 OS=Bos taurus GN=SND1 PE=1 SV=1 7 568 2.0E-90
sp|Q5REU4|SND1_PONAB Staphylococcal nuclease domain-containing protein 1 OS=Pongo abelii GN=SND1 PE=2 SV=1 7 568 2.0E-90
sp|Q7KZF4|SND1_HUMAN Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens GN=SND1 PE=1 SV=1 7 568 3.0E-90
sp|Q78PY7|SND1_MOUSE Staphylococcal nuclease domain-containing protein 1 OS=Mus musculus GN=Snd1 PE=1 SV=1 7 568 9.0E-90
sp|Q66X93|SND1_RAT Staphylococcal nuclease domain-containing protein 1 OS=Rattus norvegicus GN=Snd1 PE=1 SV=1 7 568 2.0E-89
sp|Q7ZT42|SND1_DANRE Staphylococcal nuclease domain-containing protein 1 OS=Danio rerio GN=snd1 PE=2 SV=1 7 568 6.0E-89
sp|Q5REU4|SND1_PONAB Staphylococcal nuclease domain-containing protein 1 OS=Pongo abelii GN=SND1 PE=2 SV=1 34 451 3.0E-10
sp|Q7KZF4|SND1_HUMAN Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens GN=SND1 PE=1 SV=1 34 451 3.0E-10
sp|Q863B3|SND1_BOVIN Staphylococcal nuclease domain-containing protein 1 OS=Bos taurus GN=SND1 PE=1 SV=1 34 451 1.0E-09
sp|Q78PY7|SND1_MOUSE Staphylococcal nuclease domain-containing protein 1 OS=Mus musculus GN=Snd1 PE=1 SV=1 34 451 1.0E-08
sp|Q66X93|SND1_RAT Staphylococcal nuclease domain-containing protein 1 OS=Rattus norvegicus GN=Snd1 PE=1 SV=1 34 451 2.0E-08
sp|Q7ZT42|SND1_DANRE Staphylococcal nuclease domain-containing protein 1 OS=Danio rerio GN=snd1 PE=2 SV=1 34 462 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4723
MANMFIGNVKSVLSGDTLVLTSPNNPAAERIFSLAYVSAPHLRRDGDEPFAFHSREHLRNLVVGKPVQCSVLYTI
PSTSREFGTAKLKDGTELPEELVKAGWLKVREDAGRKEESEENTERVEKLRSLEAQARAESKGLWVGTGGIIDVQ
NDLGGPDFIKEWKGKTVDGIVERVLSGDRLVVRLLLSDKKHVQPMTLLAGIRTPATERTLPSTGAVQPAEEYGNE
ARQFVETRLLQRQVKVDIVGASPQGQLVATVIHPRGNVAEFLLMEGLARCNDFHSTMLGDKMAPLRAAEKQAQTN
KLRMHKHHVAKADGGNQEMTVTKIIGADTILVRNKAGSVEKRISFSSVRGPRAGEPTESPFRDEAKEFLRQKLIG
KNVKISVDGTKPAADGFEARDVATVTDKGKNVGLMLVEAGWASVIRHRKDDTDRASNYDELLAAQEKAKEEKKGM
WCGKPQKAKQYVDLSENTQKAKIMLATLQRQKKVPAIVDFCKAGSRFTILIPRESIKLTMVLGGIRAPRAPRADG
EGGEPFGKEALDLANRRCNQRDCEVDIHDMDKVGGFIGDLYVNLG
Coding >Ophio5|4723
ATGGCCAACATGTTCATCGGCAACGTCAAGAGCGTCCTGAGCGGTGACACTCTGGTACTGACGAGCCCCAACAAT
CCGGCCGCCGAACGCATCTTCTCGCTGGCCTATGTGTCTGCTCCGCACCTCCGAAGAGACGGCGACGAGCCCTTC
GCCTTCCACTCCCGCGAGCACTTGCGCAACCTGGTCGTCGGCAAGCCCGTACAATGTTCAGTGCTTTATACCATC
CCCTCGACCTCGCGCGAGTTCGGCACCGCCAAACTCAAGGACGGCACCGAGCTGCCCGAGGAGCTGGTCAAGGCC
GGCTGGCTCAAGGTCCGCGAAGACGCCGGTCGAAAGGAGGAGTCGGAGGAGAATACGGAGCGGGTTGAGAAGCTC
CGCTCGCTCGAGGCTCAGGCTAGGGCCGAGAGCAAGGGACTGTGGGTCGGCACCGGCGGCATCATCGACGTCCAG
AACGACCTCGGCGGCCCCGACTTCATCAAGGAGTGGAAGGGCAAGACCGTCGACGGCATCGTCGAGCGTGTCTTG
AGCGGTGACCGTCTCGTCGTCCGCTTGCTGCTCTCGGACAAGAAGCACGTCCAGCCCATGACGCTCTTGGCCGGC
ATCCGCACCCCGGCCACGGAGAGGACGCTGCCCTCTACTGGAGCCGTTCAGCCGGCCGAGGAGTACGGCAACGAA
GCGCGACAGTTCGTCGAGACTCGCCTGCTGCAGCGCCAGGTCAAAGTCGATATCGTCGGCGCCAGCCCACAGGGG
CAGCTGGTGGCCACTGTCATTCACCCGCGAGGCAACGTGGCCGAGTTCCTCCTCATGGAAGGCCTGGCCAGATGC
AACGACTTCCACTCCACCATGCTGGGCGACAAGATGGCGCCCTTGCGCGCCGCCGAGAAGCAGGCTCAGACCAAC
AAACTCCGCATGCACAAGCACCACGTGGCCAAGGCAGACGGCGGCAACCAGGAGATGACGGTGACCAAGATCATC
GGTGCCGACACTATCCTCGTCAGGAATAAGGCCGGTTCCGTCGAGAAGAGAATCAGCTTCAGCAGCGTGCGCGGA
CCTCGGGCCGGAGAGCCAACTGAAAGCCCATTCCGCGACGAGGCCAAGGAATTCTTGCGTCAAAAGCTCATCGGC
AAGAACGTCAAGATTAGCGTCGACGGCACCAAGCCAGCCGCGGATGGCTTCGAGGCCAGGGACGTTGCCACCGTA
ACGGACAAGGGCAAAAACGTGGGCTTGATGCTGGTCGAGGCCGGCTGGGCCTCCGTCATCCGTCACCGCAAGGAC
GACACGGACAGAGCCTCCAATTATGACGAGCTGCTGGCCGCCCAGGAAAAGGCCAAGGAGGAGAAGAAGGGCATG
TGGTGCGGAAAGCCGCAAAAGGCCAAGCAGTATGTCGATTTGTCGGAAAACACGCAAAAGGCCAAGATCATGCTC
GCCACGCTGCAGCGGCAGAAGAAGGTTCCCGCCATTGTCGACTTTTGCAAGGCCGGCTCTCGCTTCACCATACTG
ATCCCCCGCGAGTCCATCAAGCTGACCATGGTCCTCGGCGGCATCCGCGCGCCCCGCGCTCCTCGGGCCGACGGG
GAGGGTGGCGAGCCGTTCGGCAAAGAGGCTCTGGACCTGGCCAACCGCCGATGCAACCAGCGTGATTGCGAGGTG
GACATCCACGACATGGACAAGGTTGGTGGCTTCATCGGTGACCTCTACGTCAACCTCGGG
Transcript >Ophio5|4723
ATGGCCAACATGTTCATCGGCAACGTCAAGAGCGTCCTGAGCGGTGACACTCTGGTACTGACGAGCCCCAACAAT
CCGGCCGCCGAACGCATCTTCTCGCTGGCCTATGTGTCTGCTCCGCACCTCCGAAGAGACGGCGACGAGCCCTTC
GCCTTCCACTCCCGCGAGCACTTGCGCAACCTGGTCGTCGGCAAGCCCGTACAATGTTCAGTGCTTTATACCATC
CCCTCGACCTCGCGCGAGTTCGGCACCGCCAAACTCAAGGACGGCACCGAGCTGCCCGAGGAGCTGGTCAAGGCC
GGCTGGCTCAAGGTCCGCGAAGACGCCGGTCGAAAGGAGGAGTCGGAGGAGAATACGGAGCGGGTTGAGAAGCTC
CGCTCGCTCGAGGCTCAGGCTAGGGCCGAGAGCAAGGGACTGTGGGTCGGCACCGGCGGCATCATCGACGTCCAG
AACGACCTCGGCGGCCCCGACTTCATCAAGGAGTGGAAGGGCAAGACCGTCGACGGCATCGTCGAGCGTGTCTTG
AGCGGTGACCGTCTCGTCGTCCGCTTGCTGCTCTCGGACAAGAAGCACGTCCAGCCCATGACGCTCTTGGCCGGC
ATCCGCACCCCGGCCACGGAGAGGACGCTGCCCTCTACTGGAGCCGTTCAGCCGGCCGAGGAGTACGGCAACGAA
GCGCGACAGTTCGTCGAGACTCGCCTGCTGCAGCGCCAGGTCAAAGTCGATATCGTCGGCGCCAGCCCACAGGGG
CAGCTGGTGGCCACTGTCATTCACCCGCGAGGCAACGTGGCCGAGTTCCTCCTCATGGAAGGCCTGGCCAGATGC
AACGACTTCCACTCCACCATGCTGGGCGACAAGATGGCGCCCTTGCGCGCCGCCGAGAAGCAGGCTCAGACCAAC
AAACTCCGCATGCACAAGCACCACGTGGCCAAGGCAGACGGCGGCAACCAGGAGATGACGGTGACCAAGATCATC
GGTGCCGACACTATCCTCGTCAGGAATAAGGCCGGTTCCGTCGAGAAGAGAATCAGCTTCAGCAGCGTGCGCGGA
CCTCGGGCCGGAGAGCCAACTGAAAGCCCATTCCGCGACGAGGCCAAGGAATTCTTGCGTCAAAAGCTCATCGGC
AAGAACGTCAAGATTAGCGTCGACGGCACCAAGCCAGCCGCGGATGGCTTCGAGGCCAGGGACGTTGCCACCGTA
ACGGACAAGGGCAAAAACGTGGGCTTGATGCTGGTCGAGGCCGGCTGGGCCTCCGTCATCCGTCACCGCAAGGAC
GACACGGACAGAGCCTCCAATTATGACGAGCTGCTGGCCGCCCAGGAAAAGGCCAAGGAGGAGAAGAAGGGCATG
TGGTGCGGAAAGCCGCAAAAGGCCAAGCAGTATGTCGATTTGTCGGAAAACACGCAAAAGGCCAAGATCATGCTC
GCCACGCTGCAGCGGCAGAAGAAGGTTCCCGCCATTGTCGACTTTTGCAAGGCCGGCTCTCGCTTCACCATACTG
ATCCCCCGCGAGTCCATCAAGCTGACCATGGTCCTCGGCGGCATCCGCGCGCCCCGCGCTCCTCGGGCCGACGGG
GAGGGTGGCGAGCCGTTCGGCAAAGAGGCTCTGGACCTGGCCAACCGCCGATGCAACCAGCGTGATTGCGAGGTG
GACATCCACGACATGGACAAGGTTGGTGGCTTCATCGGTGACCTCTACGTCAACCTCGGGTAA
Gene >Ophio5|4723
ATGGCCAACATGTTCATCGGCAACGTCAAGAGCGTCCTGAGCGGTGACACTCTGGTACTGACGAGCCCCAACAAT
CCGGCCGCCGAACGCATCTTCTCGCTGGCCTATGTGTCTGCTCCGCACCTCCGAAGAGACGGCGACGAGCCCTTC
GCCTTCCACTCCCGCGAGCACTTGCGCAACCTGGTCGTCGGCAAGCCCGTACAATGTTCAGTGCTTTATACCATC
CCCTCGACCTCGCGCGAGTTCGGCACCGCCAAACTCAAGGACGGCACCGAGCTGCCCGAGGAGCTGGTCAAGGCC
GGCTGGCTCAAGGTCCGCGAAGACGCCGGTCGAAAGGAGGAGTCGGAGGAGAATACGGAGCGGGTTGAGAAGCTC
CGCTCGCTCGAGGCTCAGGCTAGGGCCGAGAGCAAGGGACTGTGGGTCGGCACCGGCGGCATCATCGACGTCCAG
AACGACCTCGGCGGCCCCGACTTCATCAAGGAGTGGAAGGGCAAGACCGTCGACGGCATCGTCGAGCGTGTCTTG
AGCGGTGACCGTCTCGTCGTCCGCTTGCTGCTCTCGGACAAGAAGCACGTCCAGCCCATGACGCTCTTGGCCGGC
ATCCGCACCCCGGCCACGGAGAGGACGCTGCCCTCTACTGGAGCCGTTCAGCCGGCCGAGGAGTACGGCAACGAA
GCGCGACAGTTCGTCGAGACTCGCCTGCTGCAGCGCCAGGTCAAAGTCGATATCGTCGGCGCCAGCCCACAGGGG
CAGCTGGTGGCCACTGTCATTCACCCGCGAGGCAACGTGGCCGAGTTCCTCCTCATGGAAGGCCTGGCCAGATGC
AACGACTTCCACTCCACCATGCTGGGCGACAAGATGGCGCCCTTGCGCGCCGCCGAGAAGCAGGCTCAGACCAAC
AAACTCCGCATGCACAAGCACCACGTGGCCAAGGCAGACGGCGGCAACCAGGAGATGACGGTGACCAAGATCATC
GGTGCCGACACTATCCTCGTCAGGAATAAGGCCGGTTCCGTCGAGAAGAGAATCAGCTTCAGCAGCGTGCGCGGA
CCTCGGGCCGGAGAGCCAACTGAAAGCCCATTCCGCGACGAGGCCAAGGAATTCTTGCGTCAAAAGCTCATCGGC
AAGAACGTCAAGATTAGCGTCGACGGCACCAAGCCAGCCGCGGATGGCTTCGAGGCCAGGGACGTTGCCACCGTA
ACGGACAAGGGCAAAAACGTGGGCTTGATGCTGGTCGAGGCCGGCTGGGCCTCCGTCATCCGTCACCGCAAGGAC
GACACGGACAGAGCCTCCAATTATGACGAGCTGCTGGCCGCCCAGGAAAAGGCCAAGGAGGAGAAGAAGGGCATG
TGGTGCGGAAAGCCGCAAAAGGCCAAGCAGTATGTCGATTTGTCGGAAAACACGCAAAAGGCCAAGATCATGCTC
GCCACGCTGCAGCGGCAGAAGAAGGTTCCCGCCATTGTCGACTTTTGCAAGGCCGGCTCTCGCTTCACCATACTG
ATCCCCCGCGAGTCCATCAAGCTGACCATGGTCCTCGGCGGCATCCGCGCGCCCCGCGCTCCTCGGGCCGACGGG
GAGGGTGGCGAGCCGTTCGGCAAAGAGGCTCTGGACCTGGCCAACCGCCGATGCAACCAGCGTGATTGCGAGGTG
GACATCCACGACATGGACAAGGTTGGTGGCTTCATCGGTGACCTCTACGTCAACCGTGAGAATTTCGCCAAGGTG
TTGGTCGAGGAGGGACTCGCGTCGGTGCATGCCTACTCGGCCGAGAAGTCGGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail