Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4715
Gene name
Locationscaffold_377:5086..5478
Strand-
Gene length (bp)392
Transcript length (bp)279
Coding sequence length (bp)276
Protein length (aa) 92

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 43 65 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 56.63 15.82 97.43
CcL In ants, during behavior modification 44.77 11.23 78.30
CcD In ants, recently dead 53.46 15.15 91.77

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.550390 no
SC16a CcD 0.900338 no
CcL CcD 0.663724 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4715
MHPFSILTLGIFVAGYITARWDLVTRLYELAIFAAENGVVTRAARGLAGLTALFLTIFVPVVFLARKETNLHPRT
LGIGFSAREQLRRRGSF
Coding >Ophio5|4715
ATGCACCCCTTCTCCATCCTCACGCTCGGCATCTTCGTAGCTGGCTATATAACCGCCCGCTGGGATCTCGTCACC
CGCCTCTATGAACTGGCCATCTTTGCCGCCGAGAACGGAGTCGTGACACGCGCTGCTAGAGGTCTCGCCGGCCTG
ACGGCCTTGTTCCTCACCATCTTCGTTCCCGTCGTCTTCCTCGCCAGGAAGGAGACGAATCTGCATCCGCGCACG
CTGGGCATCGGCTTTTCTGCGCGGGAGCAGCTCAGGCGGCGCGGCTCCTTC
Transcript >Ophio5|4715
ATGCACCCCTTCTCCATCCTCACGCTCGGCATCTTCGTAGCTGGCTATATAACCGCCCGCTGGGATCTCGTCACC
CGCCTCTATGAACTGGCCATCTTTGCCGCCGAGAACGGAGTCGTGACACGCGCTGCTAGAGGTCTCGCCGGCCTG
ACGGCCTTGTTCCTCACCATCTTCGTTCCCGTCGTCTTCCTCGCCAGGAAGGAGACGAATCTGCATCCGCGCACG
CTGGGCATCGGCTTTTCTGCGCGGGAGCAGCTCAGGCGGCGCGGCTCCTTCTGA
Gene >Ophio5|4715
ATGCACCCCTTCTCCATCCTCACGCTCGGCATCTTCGTAGCTGGCTATATAACCGCCCGCTGGGATCTCGTCACC
CGCCTCTATGAACTGGCCATCTTTGCCGCCGAGAACGGAGTCGTGGTGGGTTTCTTCCGTTGTTAAGTGGACATG
TCGTGGCGCTAACGCCGAGGCGTGGCCAGACACGCGCTGCTAGAGGTCTCGCCGGCCTGACGGCCTTGTTCCTCA
CCATCTTCGTTCCCGTCGTCTTCCTCGCCAGGAAGGAGACGAATCTGGTAATGCCAGCATTCTCGACGTATCGCT
CGACGAGGCTGACGAGCTCGGCCCAGCATCCGCGCACGCTGGGCATCGGCTTTTCTGCGCGGGAGCAGCTCAGGC
GGCGCGGCTCCTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail