Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4714
Gene name
Locationscaffold_377:2672..5052
Strand-
Gene length (bp)2380
Transcript length (bp)2115
Coding sequence length (bp)2112
Protein length (aa) 704

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05024 Gpi1 N-acetylglucosaminyl transferase component (Gpi1) 4.1E-111 299 574

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14357|GPI1_SCHPO N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein gpi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi1 PE=2 SV=1 9 662 6.0E-125
sp|P53306|GPI1_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase subunit GPI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI1 PE=1 SV=1 126 673 7.0E-73
sp|Q9QYT7|PIGQ_MOUSE Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q OS=Mus musculus GN=Pigq PE=1 SV=3 363 614 9.0E-50
sp|Q9BRB3|PIGQ_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q OS=Homo sapiens GN=PIGQ PE=1 SV=3 337 572 1.0E-40

GO

GO Term Description Terminal node
GO:0006506 GPI anchor biosynthetic process Yes
GO:0016021 integral component of membrane Yes
GO:0006497 protein lipidation No
GO:0006793 phosphorus metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0043412 macromolecule modification No
GO:1901576 organic substance biosynthetic process No
GO:0006664 glycolipid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008654 phospholipid biosynthetic process No
GO:0006644 phospholipid metabolic process No
GO:0031224 intrinsic component of membrane No
GO:0044238 primary metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0009247 glycolipid biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0044255 cellular lipid metabolic process No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:0045017 glycerolipid biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0046467 membrane lipid biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0006643 membrane lipid metabolic process No
GO:0006505 GPI anchor metabolic process No
GO:0019637 organophosphate metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0036211 protein modification process No
GO:0006629 lipid metabolic process No
GO:0005575 cellular_component No
GO:0019538 protein metabolic process No
GO:1903509 liposaccharide metabolic process No
GO:0009987 cellular process No
GO:0046486 glycerolipid metabolic process No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

Domain # Start End Length
1 247 269 22
2 339 361 22
3 403 425 22
4 432 452 20
5 472 489 17
6 509 531 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4714
MVEHDGLMRVFWPTDACGSHRPGVVVGWRNSTLDVFVVAVLDDAHPQDVEFHLRLGSFFRGGPYNPCRIYDVCGH
ASMHVLGVSNAPHSDTADPSWVRATTKPPLKLPTIACAKASSVQLILYDRPQPKRMQYISLEPIALALGDKSSRL
EDTQVDDEIEQQELRAKAARRKLVEKLKLHTIAHRVPSARDRALPKIVNQVNWSWELERTLQSNVGRLGPRPRRS
LSVSERVVESATTMRNYVLRRLWALFTIYLFPVLWRGFCLLLFGHRMAAEVLLLALEFRPKPGGAALKDISATAQ
QIEIRLQQFCYWPMQYSTLRQRKMNWASVTTSHPDYIRFYNSLWLVANDVIIGMALGSYIIEHADWVAAQMGDIL
RTYAVEALRRSISWLMGWPAGLKLNGELAAFLGDLFLWVIHYWSTCIEALQPVLPRLVWFIGFSSFAGASMPIAV
FSDLLSALTMHIHSFYLASARIHHWQLTILLSLFHLFRGKKHNVLRNRIDSCDYDLDQLLVGTIFFTLLSFLLPT
VVVFYLNFAVARMVIISIKAGFDTLLSCLNHFPLFALMLRVKDPRRLPGGIRFELRDGPEQKISDNEPPTSVIYL
KSIPLSFSAMFHQYFQMAHRIRKHYLSPGVLLRLLTGQFVPPINRKNLYSLQYSMLPAKRATPWEMWRALNMEPQ
KKSFPMPPMPSLASGGKRAAGSGRSRSHH
Coding >Ophio5|4714
ATGGTAGAACATGACGGGCTGATGCGAGTCTTCTGGCCGACGGACGCCTGCGGCTCCCATCGGCCGGGCGTCGTC
GTGGGGTGGAGGAACTCGACGCTGGACGTGTTCGTCGTTGCCGTTCTCGACGACGCCCACCCTCAGGACGTCGAA
TTTCATCTCAGACTCGGCTCTTTCTTCCGCGGTGGCCCCTATAACCCTTGTCGCATCTACGACGTCTGCGGCCAT
GCCTCGATGCACGTCTTGGGCGTTTCCAACGCGCCGCACTCGGACACGGCCGACCCGTCCTGGGTCCGAGCGACG
ACGAAGCCGCCGTTGAAGCTGCCGACCATCGCATGCGCCAAGGCGTCCAGCGTCCAGCTCATCCTCTACGACAGG
CCGCAGCCCAAGCGCATGCAGTACATCTCGCTCGAGCCCATAGCCTTGGCCCTCGGCGACAAGAGCTCCCGTCTC
GAGGATACTCAGGTCGACGACGAGATCGAGCAGCAGGAGCTAAGAGCCAAGGCGGCGCGGCGCAAGCTGGTGGAG
AAGCTCAAGCTGCACACCATCGCTCATCGCGTGCCCTCTGCCCGGGACAGGGCCTTGCCCAAGATTGTCAATCAG
GTCAATTGGTCGTGGGAGCTGGAGCGGACGCTGCAGAGCAACGTCGGCCGGCTCGGCCCGCGACCGAGGCGCAGC
CTGAGCGTCTCGGAGAGGGTGGTCGAGTCCGCCACGACGATGCGCAACTATGTCTTGCGCCGGCTGTGGGCTCTC
TTCACCATCTACCTGTTCCCGGTTCTGTGGCGCGGCTTCTGCCTGCTCCTCTTCGGCCACCGCATGGCCGCCGAG
GTGCTGCTGCTGGCACTCGAGTTCCGCCCCAAGCCGGGGGGCGCCGCGCTCAAGGACATCTCGGCCACGGCCCAG
CAGATTGAGATTCGGCTGCAGCAGTTTTGCTATTGGCCCATGCAATACTCGACACTGCGCCAGCGCAAGATGAAT
TGGGCGAGTGTCACCACCAGCCATCCCGACTATATTCGTTTCTACAACAGCCTCTGGCTGGTGGCCAACGACGTC
ATCATCGGCATGGCGCTCGGCTCGTACATCATCGAGCACGCCGATTGGGTGGCGGCGCAGATGGGAGATATCCTG
AGGACCTACGCAGTCGAGGCTCTCCGACGAAGCATCTCGTGGCTCATGGGATGGCCCGCCGGCCTGAAGCTCAAC
GGCGAGCTTGCGGCCTTTCTGGGCGACCTCTTTCTATGGGTGATTCACTATTGGTCCACCTGCATCGAGGCGCTA
CAACCGGTGTTACCGCGTCTTGTATGGTTCATAGGCTTCTCCTCGTTCGCCGGCGCCAGCATGCCCATTGCCGTC
TTCTCGGACCTGCTGTCGGCTCTGACGATGCACATCCACTCGTTTTACCTGGCGTCGGCTCGCATCCACCACTGG
CAGCTCACCATCCTGCTGTCGCTGTTCCATCTCTTCCGCGGCAAGAAGCACAACGTGCTCCGCAACCGTATCGAT
TCGTGCGACTACGACCTGGACCAGCTGCTCGTCGGCACCATCTTCTTCACCCTACTCTCCTTTTTGCTGCCGACG
GTGGTTGTCTTCTACCTCAACTTTGCCGTGGCGAGGATGGTCATCATCTCCATCAAGGCTGGCTTCGACACATTG
CTGTCGTGCCTCAATCACTTTCCGCTGTTTGCCCTGATGCTGCGTGTCAAAGATCCGAGACGGCTTCCTGGCGGC
ATTCGGTTCGAGCTCCGGGATGGCCCCGAGCAGAAGATATCCGACAACGAGCCGCCCACGTCTGTCATCTACCTC
AAGTCGATCCCGCTATCCTTCAGCGCCATGTTCCACCAATACTTCCAGATGGCTCACCGGATCCGCAAGCACTAC
CTCTCGCCCGGAGTGCTCCTCCGACTGCTGACGGGCCAGTTCGTGCCACCCATCAACAGGAAGAACCTGTATAGC
TTGCAGTACAGCATGCTTCCGGCCAAGAGGGCAACGCCGTGGGAGATGTGGCGCGCGCTCAACATGGAGCCGCAG
AAGAAGTCGTTTCCGATGCCGCCGATGCCGTCGCTGGCGAGTGGGGGGAAGAGGGCTGCGGGGAGTGGGCGGTCG
AGGTCGCACCAT
Transcript >Ophio5|4714
ATGGTAGAACATGACGGGCTGATGCGAGTCTTCTGGCCGACGGACGCCTGCGGCTCCCATCGGCCGGGCGTCGTC
GTGGGGTGGAGGAACTCGACGCTGGACGTGTTCGTCGTTGCCGTTCTCGACGACGCCCACCCTCAGGACGTCGAA
TTTCATCTCAGACTCGGCTCTTTCTTCCGCGGTGGCCCCTATAACCCTTGTCGCATCTACGACGTCTGCGGCCAT
GCCTCGATGCACGTCTTGGGCGTTTCCAACGCGCCGCACTCGGACACGGCCGACCCGTCCTGGGTCCGAGCGACG
ACGAAGCCGCCGTTGAAGCTGCCGACCATCGCATGCGCCAAGGCGTCCAGCGTCCAGCTCATCCTCTACGACAGG
CCGCAGCCCAAGCGCATGCAGTACATCTCGCTCGAGCCCATAGCCTTGGCCCTCGGCGACAAGAGCTCCCGTCTC
GAGGATACTCAGGTCGACGACGAGATCGAGCAGCAGGAGCTAAGAGCCAAGGCGGCGCGGCGCAAGCTGGTGGAG
AAGCTCAAGCTGCACACCATCGCTCATCGCGTGCCCTCTGCCCGGGACAGGGCCTTGCCCAAGATTGTCAATCAG
GTCAATTGGTCGTGGGAGCTGGAGCGGACGCTGCAGAGCAACGTCGGCCGGCTCGGCCCGCGACCGAGGCGCAGC
CTGAGCGTCTCGGAGAGGGTGGTCGAGTCCGCCACGACGATGCGCAACTATGTCTTGCGCCGGCTGTGGGCTCTC
TTCACCATCTACCTGTTCCCGGTTCTGTGGCGCGGCTTCTGCCTGCTCCTCTTCGGCCACCGCATGGCCGCCGAG
GTGCTGCTGCTGGCACTCGAGTTCCGCCCCAAGCCGGGGGGCGCCGCGCTCAAGGACATCTCGGCCACGGCCCAG
CAGATTGAGATTCGGCTGCAGCAGTTTTGCTATTGGCCCATGCAATACTCGACACTGCGCCAGCGCAAGATGAAT
TGGGCGAGTGTCACCACCAGCCATCCCGACTATATTCGTTTCTACAACAGCCTCTGGCTGGTGGCCAACGACGTC
ATCATCGGCATGGCGCTCGGCTCGTACATCATCGAGCACGCCGATTGGGTGGCGGCGCAGATGGGAGATATCCTG
AGGACCTACGCAGTCGAGGCTCTCCGACGAAGCATCTCGTGGCTCATGGGATGGCCCGCCGGCCTGAAGCTCAAC
GGCGAGCTTGCGGCCTTTCTGGGCGACCTCTTTCTATGGGTGATTCACTATTGGTCCACCTGCATCGAGGCGCTA
CAACCGGTGTTACCGCGTCTTGTATGGTTCATAGGCTTCTCCTCGTTCGCCGGCGCCAGCATGCCCATTGCCGTC
TTCTCGGACCTGCTGTCGGCTCTGACGATGCACATCCACTCGTTTTACCTGGCGTCGGCTCGCATCCACCACTGG
CAGCTCACCATCCTGCTGTCGCTGTTCCATCTCTTCCGCGGCAAGAAGCACAACGTGCTCCGCAACCGTATCGAT
TCGTGCGACTACGACCTGGACCAGCTGCTCGTCGGCACCATCTTCTTCACCCTACTCTCCTTTTTGCTGCCGACG
GTGGTTGTCTTCTACCTCAACTTTGCCGTGGCGAGGATGGTCATCATCTCCATCAAGGCTGGCTTCGACACATTG
CTGTCGTGCCTCAATCACTTTCCGCTGTTTGCCCTGATGCTGCGTGTCAAAGATCCGAGACGGCTTCCTGGCGGC
ATTCGGTTCGAGCTCCGGGATGGCCCCGAGCAGAAGATATCCGACAACGAGCCGCCCACGTCTGTCATCTACCTC
AAGTCGATCCCGCTATCCTTCAGCGCCATGTTCCACCAATACTTCCAGATGGCTCACCGGATCCGCAAGCACTAC
CTCTCGCCCGGAGTGCTCCTCCGACTGCTGACGGGCCAGTTCGTGCCACCCATCAACAGGAAGAACCTGTATAGC
TTGCAGTACAGCATGCTTCCGGCCAAGAGGGCAACGCCGTGGGAGATGTGGCGCGCGCTCAACATGGAGCCGCAG
AAGAAGTCGTTTCCGATGCCGCCGATGCCGTCGCTGGCGAGTGGGGGGAAGAGGGCTGCGGGGAGTGGGCGGTCG
AGGTCGCACCATTAG
Gene >Ophio5|4714
ATGGTAGAACATGACGGGCTGATGCGAGTCTTCTGGCCGACGGACGCCTGCGGCTCCCATCGGCCGGGCGTCGTC
GTGGGGTGGAGGAACTCGACGCTGGACGTGTTCGTCGTTGCCGTTCTCGACGACGCCCACGTACGTTGGCCACTT
GCTTGACTCCATCTTCGCTTCTCGACTCTGGCTGACCAGGCTTCAGCCTCAGGACGTCGAATTTCATCTCAGACT
CGGCTCTTTCTTCCGCGGTGGCCCCTATAACCCTTGTCGCATCTACGACGTCTGCGGCCATGCCTCGATGCACGT
CTTGGGCGTTTCCAACGCGCCGCACTCGGACACGGCCGACCCGTCCTGGGTCCGAGCGACGACGAAGCCGCCGTT
GAAGCTGCCGACCATCGCATGCGCCAAGGCGTCCAGCGTCCAGCTCATCCTCTACGACAGGCCGCAGCCCAAGCG
CATGCAGTACATCTCGCTCGAGCCCATAGCCTTGGCCCTCGGCGACAAGAGCTCCCGTCTCGAGGATACTCAGGT
CGACGACGAGATCGAGCAGCAGGAGCTAAGAGCCAAGGCGGCGCGGCGCAAGCTGGTGGAGAAGCTCAAGCTGCA
CACCATCGCTCATCGCGTGCCCTCTGCCCGGGACAGGGCCTTGCCCAAGATTGTCAATCAGGTCAATTGGTCGTG
GGAGCTGGAGCGGACGCTGCAGAGCAACGTCGGCCGGCTCGGCCCGCGACCGAGGCGCAGCCTGAGCGTCTCGGA
GAGGGTGGTCGAGTCCGCCACGACGATGCGCAACTATGTCTTGCGCCGGCTGTGGGCTCTCTTCACCATCTACCT
GTTCCCGGTTCTGTGGCGCGGCTTCTGCCTGCTCCTCTTCGGCCACCGCATGGCCGCCGAGGTGCTGCTGCTGGC
ACTCGAGTTCCGCCCCAAGCCGGGGGGCGCCGCGCTCAAGGACATCTCGGCCACGGCCCAGCAGATTGAGATTCG
GCTGCAGCAGTTTTGCTATTGGCCCATGCAATACTCGACACTGCGCCAGCGCAAGATGAATTGGGCGAGTGTCAC
CACCAGCCATCCCGACTATATTCGTTTCTACAACAGCCTCTGGCTGGTGGCCAACGACGTCATCATCGGCATGGC
GCTCGGCTCGTACATCATCGAGCACGCCGATTGGGTGGCGGCGCAGATGGGAGATATCCTGAGGACCTACGCAGT
CGAGGCTCTCCGACGAAGCATCTCGTGGCTCATGGGATGGCCCGCCGGCCTGAAGCTCAACGGCGAGCTTGCGGC
CTTTCTGGGCGACCTCTTTCTATGGGTGATTCACTATTGGTCCAGTAAGTCTCGTGCCGCCCGGTGCCGTGCGAG
AGCTAACAGGGAGCTTTTGCGACAGCCTGCATCGAGGCGCTACAACCGGTGTTACCGCGTCTTGTATGGTTCATA
GGCTTCTCCTCGTTCGCCGGCGCCAGCATGCCCATTGCCGTCTTCTCGGACCTGCTGTCGGCTCTGACGATGCAC
ATCCACTCGTTTTACCTGGCGTCGGCTCGCATCCACCACTGGCAGCTCACCATCCTGCTGTCGCTGTTCCATCTC
TTCCGCGGCAAGAAGCACAACGTGCTCCGCAACCGTATCGATTCGTGCGACTACGACCTGGACCAGCTGCTCGTC
GGCACCATCTTCTTCACCCTACTCTCCTTTTTGCTGCCGACGGTGGTTGTCTTCTACCTCAACTTTGCCGTGGCG
AGGATGGTCATCATCTCCATCAAGGCTGGCTTCGACACATTGCTGTCGTGCCTCAATCACTTTCCGCTGTTTGCC
CTGATGCTGCGTGTCAAAGATCCGAGACGGCTTCCTGGTGAGTTGAAGTCGAAGTGATGAGATGAAAAGGGGAAA
AAAAAGGGGGGGGNNGGGGGGGGGGGGACTTTGAGTCGGGCTGACTCGATGCAAGGCGGCATTCGGTTCGAGCTC
CGGGATGGCCCCGAGCAGAAGATATCCGACAACGAGCCGCCCACGTCTGTCATCTACCTCAAGGTCAGTCGCCCC
AGTCACGCCGTGGCCAGCTGGGCCTTTGGCTGACACGACACAGTCGATCCCGCTATCCTTCAGCGCCATGTTCCA
CCAATACTTCCAGATGGCTCACCGGATCCGCAAGCACTACCTCTCGCCCGGAGTGCTCCTCCGACTGCTGACGGG
CCAGTTCGTGCCACCCATCAACAGGAAGAACCTGTATAGCTTGCAGTACAGCATGCTTCCGGCCAAGAGGGCAAC
GCCGTGGGAGATGTGGCGCGCGCTCAACATGGAGCCGCAGAAGAAGTCGTTTCCGATGCCGCCGATGCCGTCGCT
GGCGAGTGGGGGGAAGAGGGCTGCGGGGAGTGGGCGGTCGAGGTCGCACCATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail