Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4710
Gene name
Locationscaffold_376:15985..17170
Strand+
Gene length (bp)1185
Transcript length (bp)1185
Coding sequence length (bp)1182
Protein length (aa) 394

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 5.0E-10 110 339

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A7N0G6|APAH_VIBCB Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=apaH PE=3 SV=1 113 364 6.0E-14
sp|Q87ST8|APAH_VIBPA Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=apaH PE=3 SV=1 113 364 7.0E-14
sp|A1W551|APAH_ACISJ Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Acidovorax sp. (strain JS42) GN=apaH PE=3 SV=1 111 365 3.0E-11
sp|Q3JBF6|APAH_NITOC Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=apaH PE=3 SV=1 111 376 4.0E-11
sp|B6J3B1|APAH_COXB2 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Coxiella burnetii (strain CbuG_Q212) GN=apaH PE=3 SV=1 109 372 7.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A7N0G6|APAH_VIBCB Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=apaH PE=3 SV=1 113 364 6.0E-14
sp|Q87ST8|APAH_VIBPA Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=apaH PE=3 SV=1 113 364 7.0E-14
sp|A1W551|APAH_ACISJ Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Acidovorax sp. (strain JS42) GN=apaH PE=3 SV=1 111 365 3.0E-11
sp|Q3JBF6|APAH_NITOC Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=apaH PE=3 SV=1 111 376 4.0E-11
sp|B6J3B1|APAH_COXB2 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Coxiella burnetii (strain CbuG_Q212) GN=apaH PE=3 SV=1 109 372 7.0E-11
sp|B9MFH8|APAH_ACIET Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Acidovorax ebreus (strain TPSY) GN=apaH PE=3 SV=1 111 365 7.0E-11
sp|C5B7N9|APAH_EDWI9 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Edwardsiella ictaluri (strain 93-146) GN=apaH PE=3 SV=1 112 365 9.0E-11
sp|Q83AB7|APAH_COXBU Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=apaH PE=3 SV=1 109 372 1.0E-10
sp|A9N9I1|APAH_COXBR Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=apaH PE=3 SV=1 109 372 1.0E-10
sp|A9KH04|APAH_COXBN Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Coxiella burnetii (strain Dugway 5J108-111) GN=apaH PE=3 SV=1 109 372 2.0E-10
sp|B6J646|APAH_COXB1 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Coxiella burnetii (strain CbuK_Q154) GN=apaH PE=3 SV=1 109 372 2.0E-10
sp|B4F2I4|APAH_PROMH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Proteus mirabilis (strain HI4320) GN=apaH PE=3 SV=1 113 365 4.0E-10
sp|Q8D3I0|APAH_WIGBR Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Wigglesworthia glossinidia brevipalpis GN=apaH PE=3 SV=1 113 365 4.0E-10
sp|Q7N8V9|APAH_PHOLL Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=apaH PE=3 SV=1 113 364 5.0E-10
sp|B8EB37|APAH_SHEB2 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Shewanella baltica (strain OS223) GN=apaH PE=3 SV=1 113 364 7.0E-10
sp|Q8ZNY9|PRP1_SALTY Serine/threonine-protein phosphatase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pphA PE=1 SV=1 107 275 9.0E-10
sp|A9L436|APAH_SHEB9 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Shewanella baltica (strain OS195) GN=apaH PE=3 SV=1 113 364 1.0E-09
sp|Q0AC59|APAH_ALKEH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=apaH PE=3 SV=1 114 372 2.0E-09
sp|A4SR08|APAH_AERS4 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Aeromonas salmonicida (strain A449) GN=apaH PE=3 SV=1 112 364 2.0E-09
sp|B2K485|APAH_YERPB Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=apaH PE=3 SV=1 113 364 2.0E-09
sp|Q66ER0|APAH_YERPS Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=apaH PE=3 SV=1 113 364 2.0E-09
sp|B1JKY5|APAH_YERPY Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=apaH PE=3 SV=1 113 364 2.0E-09
sp|Q1C0H7|APAH_YERPA Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=apaH PE=3 SV=1 113 364 2.0E-09
sp|Q8ZIK7|APAH_YERPE Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Yersinia pestis GN=apaH PE=3 SV=1 113 364 2.0E-09
sp|A9QZZ2|APAH_YERPG Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Yersinia pestis bv. Antiqua (strain Angola) GN=apaH PE=3 SV=1 113 364 2.0E-09
sp|Q1CMT4|APAH_YERPN Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=apaH PE=3 SV=1 113 364 2.0E-09
sp|A4TQE0|APAH_YERPP Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Yersinia pestis (strain Pestoides F) GN=apaH PE=3 SV=1 113 364 2.0E-09
sp|A7FMC3|APAH_YERP3 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=apaH PE=3 SV=1 113 364 2.0E-09
sp|A1JJF2|APAH_YERE8 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=apaH PE=3 SV=1 113 364 4.0E-09
sp|B4RJQ3|APAH_NEIG2 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Neisseria gonorrhoeae (strain NCCP11945) GN=apaH PE=3 SV=1 114 372 5.0E-09
sp|Q5FA03|APAH_NEIG1 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=apaH PE=3 SV=1 114 372 5.0E-09
sp|A6WK57|APAH_SHEB8 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Shewanella baltica (strain OS185) GN=apaH PE=3 SV=1 113 364 5.0E-09
sp|A6VU51|APAH_MARMS Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Marinomonas sp. (strain MWYL1) GN=apaH PE=3 SV=1 113 369 7.0E-09
sp|Q6LV43|APAH_PHOPR Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Photobacterium profundum GN=apaH PE=3 SV=1 113 364 7.0E-09
sp|Q2YCK7|APAH_NITMU Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=apaH PE=3 SV=1 111 369 1.0E-08
sp|Q1QZ29|APAH_CHRSD Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=apaH PE=3 SV=1 114 373 2.0E-08
sp|P03772|PP_LAMBD Serine/threonine-protein phosphatase OS=Enterobacteria phage lambda PE=1 SV=1 109 285 2.0E-08
sp|A8ALQ2|APAH_CITK8 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=apaH PE=3 SV=1 113 365 2.0E-08
sp|Q21MT2|APAH_SACD2 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=apaH PE=3 SV=1 114 364 2.0E-08
sp|A4Y433|APAH_SHEPC Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=apaH PE=3 SV=1 113 364 3.0E-08
sp|A1RMV0|APAH_SHESW Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Shewanella sp. (strain W3-18-1) GN=apaH PE=3 SV=1 113 364 4.0E-08
sp|A3D186|APAH_SHEB5 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=apaH PE=3 SV=1 113 364 4.0E-08
sp|A8FRV0|APAH_SHESH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Shewanella sediminis (strain HAW-EB3) GN=apaH PE=3 SV=1 113 372 8.0E-08
sp|C0Q5E5|APAH_SALPC Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Salmonella paratyphi C (strain RKS4594) GN=apaH PE=3 SV=1 113 365 9.0E-08
sp|B2VGQ8|APAH_ERWT9 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=apaH PE=3 SV=1 113 364 1.0E-07
sp|P57922|APAH_PASMU Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Pasteurella multocida (strain Pm70) GN=apaH PE=3 SV=1 113 364 1.0E-07
sp|A1STS0|APAH_PSYIN Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Psychromonas ingrahamii (strain 37) GN=apaH PE=3 SV=1 113 383 1.0E-07
sp|B5Y1Z6|APAH_KLEP3 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Klebsiella pneumoniae (strain 342) GN=apaH PE=3 SV=1 113 365 2.0E-07
sp|A8G9N8|APAH_SERP5 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Serratia proteamaculans (strain 568) GN=apaH PE=3 SV=1 113 251 2.0E-07
sp|A6UZ94|APAH_PSEA7 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Pseudomonas aeruginosa (strain PA7) GN=apaH PE=3 SV=1 114 391 2.0E-07
sp|B7M0E6|APAH_ECO8A Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Escherichia coli O8 (strain IAI1) GN=apaH PE=3 SV=1 113 365 3.0E-07
sp|Q8XA15|APAH_ECO57 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Escherichia coli O157:H7 GN=apaH PE=3 SV=1 113 365 3.0E-07
sp|B5YZ87|APAH_ECO5E Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=apaH PE=3 SV=1 113 365 3.0E-07
sp|A0L066|APAH_SHESA Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Shewanella sp. (strain ANA-3) GN=apaH PE=3 SV=1 113 364 3.0E-07
sp|C6DEY8|APAH_PECCP Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=apaH PE=3 SV=1 113 364 3.0E-07
sp|Q82WQ0|APAH_NITEU Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=apaH PE=3 SV=1 114 369 3.0E-07
sp|A7ZHE2|APAH_ECO24 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=apaH PE=3 SV=1 113 365 3.0E-07
sp|A7ZW01|APAH_ECOHS Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Escherichia coli O9:H4 (strain HS) GN=apaH PE=3 SV=1 113 365 3.0E-07
sp|B6HZ30|APAH_ECOSE Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Escherichia coli (strain SE11) GN=apaH PE=3 SV=1 113 365 3.0E-07
sp|Q0T8E6|APAH_SHIF8 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Shigella flexneri serotype 5b (strain 8401) GN=apaH PE=3 SV=1 113 365 3.0E-07
sp|Q83SQ2|APAH_SHIFL Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Shigella flexneri GN=apaH PE=1 SV=1 113 365 3.0E-07
sp|B5FGG4|APAH_VIBFM Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Vibrio fischeri (strain MJ11) GN=apaH PE=3 SV=1 113 373 3.0E-07
sp|C4ZPX5|APAH_ECOBW Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=apaH PE=3 SV=1 113 365 4.0E-07
sp|A6T4I5|APAH_KLEP7 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=apaH PE=3 SV=1 113 365 4.0E-07
sp|B7L4H2|APAH_ECO55 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Escherichia coli (strain 55989 / EAEC) GN=apaH PE=3 SV=1 113 365 4.0E-07
sp|B1XC50|APAH_ECODH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Escherichia coli (strain K12 / DH10B) GN=apaH PE=3 SV=1 113 365 4.0E-07
sp|P05637|APAH_ECOLI Bis(5'-nucleosyl)-tetraphosphatase [symmetrical] OS=Escherichia coli (strain K12) GN=apaH PE=1 SV=2 113 365 4.0E-07
sp|B2U257|APAH_SHIB3 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=apaH PE=3 SV=1 113 365 4.0E-07
sp|Q326I4|APAH_SHIBS Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Shigella boydii serotype 4 (strain Sb227) GN=apaH PE=3 SV=1 113 365 4.0E-07
sp|Q3Z5W0|APAH_SHISS Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Shigella sonnei (strain Ss046) GN=apaH PE=3 SV=1 113 365 4.0E-07
sp|B1IRC7|APAH_ECOLC Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=apaH PE=3 SV=1 113 365 4.0E-07
sp|B1LFY5|APAH_ECOSM Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=apaH PE=3 SV=1 113 365 5.0E-07
sp|B7NHF5|APAH_ECO7I Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=apaH PE=3 SV=1 113 365 5.0E-07
sp|B7N7S4|APAH_ECOLU Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=apaH PE=3 SV=1 113 365 5.0E-07
sp|B7LVU3|APAH_ESCF3 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=apaH PE=3 SV=1 113 365 5.0E-07
sp|A0KGT6|APAH_AERHH Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=apaH PE=3 SV=1 112 364 5.0E-07
sp|Q0TLT8|APAH_ECOL5 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=apaH PE=3 SV=1 113 365 6.0E-07
sp|B7MNQ8|APAH_ECO81 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Escherichia coli O81 (strain ED1a) GN=apaH PE=3 SV=1 113 365 6.0E-07
sp|Q5P6P9|APAH_AROAE Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Aromatoleum aromaticum (strain EbN1) GN=apaH PE=3 SV=1 111 369 7.0E-07
sp|Q8FL98|APAH_ECOL6 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=apaH PE=3 SV=1 113 365 8.0E-07
sp|B7UI97|APAH_ECO27 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=apaH PE=3 SV=1 113 365 8.0E-07
sp|Q8EB91|APAH_SHEON Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Shewanella oneidensis (strain MR-1) GN=apaH PE=3 SV=1 113 364 9.0E-07
sp|Q1RGE8|APAH_ECOUT Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Escherichia coli (strain UTI89 / UPEC) GN=apaH PE=3 SV=1 113 365 1.0E-06
sp|A1A798|APAH_ECOK1 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Escherichia coli O1:K1 / APEC GN=apaH PE=3 SV=1 113 365 1.0E-06
sp|B7MAH4|APAH_ECO45 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=apaH PE=3 SV=1 113 365 1.0E-06
sp|Q32K45|APAH_SHIDS Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=apaH PE=3 SV=1 113 365 1.0E-06
sp|Q47VJ7|APAH_COLP3 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=apaH PE=3 SV=1 111 252 1.0E-06
sp|Q0HS04|APAH_SHESR Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Shewanella sp. (strain MR-7) GN=apaH PE=3 SV=1 113 364 2.0E-06
sp|C4K4K8|APAH_HAMD5 Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=apaH PE=3 SV=1 113 246 2.0E-06
sp|C4L9L6|APAH_TOLAT Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=apaH PE=3 SV=1 113 364 2.0E-06
sp|Q0HLT4|APAH_SHESM Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Shewanella sp. (strain MR-4) GN=apaH PE=3 SV=1 113 364 2.0E-06
sp|Q6D0D8|APAH_PECAS Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=apaH PE=3 SV=1 113 246 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 12 29 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4710
MSSLSAAQQRILVFAATFFFIASVYLSTTRLFNMSFSSQDGRSPQLTHRNRKQHAPAPIHHHPPSADMAVAPADL
PMSYGEYRRPGLDGLDKMVATLPLHLVPSLDNRRRLIVIGDIHGMDQELARLLHVVGFDTHGDHVVAAGDMVGKG
PNSTAVVDRLMSLEASAVRGNHEDRVLLSRAEADAARGLLGAQLAETDAPLRTGQADALAVARSLSASQVAWLSR
LPVVLSVDPLPLYIVHAGLVPGVALEKQDPWAVMNMRTLIYPREELRTKQRLKEAKGTTTTGTTKAAMDRGTSLD
RAVAVPVENHKGEPWADGWNRFQEGEPEPKRRTVVYGHDARVGHVEGRYTLGLDSGCVRGGALTAAVIQAAEHGG
FNHTTVRVACRKPASPEQS
Coding >Ophio5|4710
ATGTCATCCCTCTCGGCGGCGCAACAGCGCATCCTTGTCTTCGCCGCCACCTTCTTCTTCATCGCGAGCGTCTAC
CTGAGCACGACTCGTCTCTTCAACATGTCCTTTTCCAGCCAAGACGGCCGCTCACCGCAGCTGACGCATCGGAAC
CGAAAGCAACACGCCCCAGCCCCGATCCATCATCATCCGCCGTCGGCTGACATGGCCGTCGCCCCGGCTGATCTG
CCCATGTCGTACGGGGAGTATCGACGGCCTGGTCTCGATGGGTTGGACAAGATGGTTGCGACGCTTCCGCTGCAT
CTGGTGCCGTCGCTTGATAATAGGAGGCGTCTGATTGTGATTGGGGATATACATGGCATGGATCAGGAGTTGGCA
CGGCTGTTGCATGTCGTCGGCTTCGATACCCATGGCGATCATGTCGTTGCCGCAGGAGACATGGTCGGAAAGGGC
CCAAACTCAACCGCCGTCGTCGATCGACTGATGAGTCTTGAAGCCAGCGCCGTCCGCGGCAACCACGAAGACCGC
GTCCTCCTTTCTCGAGCAGAAGCCGATGCCGCCCGAGGCCTTCTGGGTGCCCAACTGGCCGAGACCGATGCCCCG
CTTCGAACCGGCCAAGCCGACGCCCTCGCCGTCGCTCGCTCCCTGTCGGCCAGTCAGGTTGCCTGGCTGTCCCGG
CTACCCGTCGTGCTCAGCGTCGACCCGCTGCCGTTATACATCGTCCACGCCGGTCTCGTCCCCGGCGTTGCGCTC
GAGAAGCAGGACCCGTGGGCTGTCATGAATATGCGGACCCTCATCTACCCACGTGAGGAGCTGCGTACCAAGCAG
CGTCTTAAAGAGGCCAAAGGGACGACGACGACGGGGACGACCAAAGCCGCTATGGATAGGGGTACTAGCCTCGAC
CGCGCCGTCGCCGTCCCCGTTGAGAATCACAAGGGCGAGCCTTGGGCAGATGGCTGGAATCGCTTTCAGGAGGGC
GAGCCTGAGCCGAAGCGGCGCACTGTCGTTTACGGCCACGATGCCCGCGTCGGCCACGTCGAGGGGAGATACACC
TTGGGGCTCGACTCCGGATGTGTCCGTGGCGGCGCCCTGACTGCCGCCGTCATCCAAGCTGCCGAGCATGGGGGC
TTTAACCACACCACTGTCCGGGTAGCGTGCCGCAAGCCGGCCTCTCCCGAGCAGAGT
Transcript >Ophio5|4710
ATGTCATCCCTCTCGGCGGCGCAACAGCGCATCCTTGTCTTCGCCGCCACCTTCTTCTTCATCGCGAGCGTCTAC
CTGAGCACGACTCGTCTCTTCAACATGTCCTTTTCCAGCCAAGACGGCCGCTCACCGCAGCTGACGCATCGGAAC
CGAAAGCAACACGCCCCAGCCCCGATCCATCATCATCCGCCGTCGGCTGACATGGCCGTCGCCCCGGCTGATCTG
CCCATGTCGTACGGGGAGTATCGACGGCCTGGTCTCGATGGGTTGGACAAGATGGTTGCGACGCTTCCGCTGCAT
CTGGTGCCGTCGCTTGATAATAGGAGGCGTCTGATTGTGATTGGGGATATACATGGCATGGATCAGGAGTTGGCA
CGGCTGTTGCATGTCGTCGGCTTCGATACCCATGGCGATCATGTCGTTGCCGCAGGAGACATGGTCGGAAAGGGC
CCAAACTCAACCGCCGTCGTCGATCGACTGATGAGTCTTGAAGCCAGCGCCGTCCGCGGCAACCACGAAGACCGC
GTCCTCCTTTCTCGAGCAGAAGCCGATGCCGCCCGAGGCCTTCTGGGTGCCCAACTGGCCGAGACCGATGCCCCG
CTTCGAACCGGCCAAGCCGACGCCCTCGCCGTCGCTCGCTCCCTGTCGGCCAGTCAGGTTGCCTGGCTGTCCCGG
CTACCCGTCGTGCTCAGCGTCGACCCGCTGCCGTTATACATCGTCCACGCCGGTCTCGTCCCCGGCGTTGCGCTC
GAGAAGCAGGACCCGTGGGCTGTCATGAATATGCGGACCCTCATCTACCCACGTGAGGAGCTGCGTACCAAGCAG
CGTCTTAAAGAGGCCAAAGGGACGACGACGACGGGGACGACCAAAGCCGCTATGGATAGGGGTACTAGCCTCGAC
CGCGCCGTCGCCGTCCCCGTTGAGAATCACAAGGGCGAGCCTTGGGCAGATGGCTGGAATCGCTTTCAGGAGGGC
GAGCCTGAGCCGAAGCGGCGCACTGTCGTTTACGGCCACGATGCCCGCGTCGGCCACGTCGAGGGGAGATACACC
TTGGGGCTCGACTCCGGATGTGTCCGTGGCGGCGCCCTGACTGCCGCCGTCATCCAAGCTGCCGAGCATGGGGGC
TTTAACCACACCACTGTCCGGGTAGCGTGCCGCAAGCCGGCCTCTCCCGAGCAGAGTTGA
Gene >Ophio5|4710
ATGTCATCCCTCTCGGCGGCGCAACAGCGCATCCTTGTCTTCGCCGCCACCTTCTTCTTCATCGCGAGCGTCTAC
CTGAGCACGACTCGTCTCTTCAACATGTCCTTTTCCAGCCAAGACGGCCGCTCACCGCAGCTGACGCATCGGAAC
CGAAAGCAACACGCCCCAGCCCCGATCCATCATCATCCGCCGTCGGCTGACATGGCCGTCGCCCCGGCTGATCTG
CCCATGTCGTACGGGGAGTATCGACGGCCTGGTCTCGATGGGTTGGACAAGATGGTTGCGACGCTTCCGCTGCAT
CTGGTGCCGTCGCTTGATAATAGGAGGCGTCTGATTGTGATTGGGGATATACATGGCATGGATCAGGAGTTGGCA
CGGCTGTTGCATGTCGTCGGCTTCGATACCCATGGCGATCATGTCGTTGCCGCAGGAGACATGGTCGGAAAGGGC
CCAAACTCAACCGCCGTCGTCGATCGACTGATGAGTCTTGAAGCCAGCGCCGTCCGCGGCAACCACGAAGACCGC
GTCCTCCTTTCTCGAGCAGAAGCCGATGCCGCCCGAGGCCTTCTGGGTGCCCAACTGGCCGAGACCGATGCCCCG
CTTCGAACCGGCCAAGCCGACGCCCTCGCCGTCGCTCGCTCCCTGTCGGCCAGTCAGGTTGCCTGGCTGTCCCGG
CTACCCGTCGTGCTCAGCGTCGACCCGCTGCCGTTATACATCGTCCACGCCGGTCTCGTCCCCGGCGTTGCGCTC
GAGAAGCAGGACCCGTGGGCTGTCATGAATATGCGGACCCTCATCTACCCACGTGAGGAGCTGCGTACCAAGCAG
CGTCTTAAAGAGGCCAAAGGGACGACGACGACGGGGACGACCAAAGCCGCTATGGATAGGGGTACTAGCCTCGAC
CGCGCCGTCGCCGTCCCCGTTGAGAATCACAAGGGCGAGCCTTGGGCAGATGGCTGGAATCGCTTTCAGGAGGGC
GAGCCTGAGCCGAAGCGGCGCACTGTCGTTTACGGCCACGATGCCCGCGTCGGCCACGTCGAGGGGAGATACACC
TTGGGGCTCGACTCCGGATGTGTCCGTGGCGGCGCCCTGACTGCCGCCGTCATCCAAGCTGCCGAGCATGGGGGC
TTTAACCACACCACTGTCCGGGTAGCGTGCCGCAAGCCGGCCTCTCCCGAGCAGAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail