Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|471
Gene name
Locationscaffold_1108:1102..2929
Strand+
Gene length (bp)1827
Transcript length (bp)1827
Coding sequence length (bp)1824
Protein length (aa) 608

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01753 zf-MYND MYND finger 4.7E-06 564 603

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1DDX0|MUB1_NEOFI MYND-type zinc finger protein samB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=samB PE=3 SV=1 1 603 0.0E+00
sp|A2RA63|MUB1_ASPNC MYND-type zinc finger protein samB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=samB PE=3 SV=1 1 603 0.0E+00
sp|B0Y1D1|MUB1_ASPFC MYND-type zinc finger protein samB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=samB PE=3 SV=1 1 603 0.0E+00
sp|Q4WVI6|MUB1_ASPFU MYND-type zinc finger protein samB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=samB PE=3 SV=1 1 603 0.0E+00
sp|Q2U685|MUB1_ASPOR MYND-type zinc finger protein samB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=samB PE=3 SV=1 1 603 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1DDX0|MUB1_NEOFI MYND-type zinc finger protein samB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=samB PE=3 SV=1 1 603 0.0E+00
sp|A2RA63|MUB1_ASPNC MYND-type zinc finger protein samB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=samB PE=3 SV=1 1 603 0.0E+00
sp|B0Y1D1|MUB1_ASPFC MYND-type zinc finger protein samB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=samB PE=3 SV=1 1 603 0.0E+00
sp|Q4WVI6|MUB1_ASPFU MYND-type zinc finger protein samB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=samB PE=3 SV=1 1 603 0.0E+00
sp|Q2U685|MUB1_ASPOR MYND-type zinc finger protein samB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=samB PE=3 SV=1 1 603 0.0E+00
sp|B8NKS1|MUB1_ASPFN MYND-type zinc finger protein samB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=samB PE=3 SV=1 1 603 0.0E+00
sp|A1CBG9|MUB1_ASPCL MYND-type zinc finger protein samB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=samB PE=3 SV=1 1 603 0.0E+00
sp|Q0CW83|MUB1_ASPTN MYND-type zinc finger protein samB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=samB PE=3 SV=1 1 603 0.0E+00
sp|O42631|MUB1_EMENI MYND-type zinc finger protein samB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=samB PE=3 SV=1 1 603 0.0E+00
sp|P87311|MUB1_SCHPO MYND-type zinc finger protein C31F10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC31F10.10c PE=3 SV=1 447 603 2.0E-41
sp|P87311|MUB1_SCHPO MYND-type zinc finger protein C31F10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC31F10.10c PE=3 SV=1 1 127 3.0E-39
sp|Q03162|MUB1_YEAST MYND-type zinc finger protein MUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MUB1 PE=1 SV=1 513 603 5.0E-32
sp|Q03162|MUB1_YEAST MYND-type zinc finger protein MUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MUB1 PE=1 SV=1 1 123 3.0E-27
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|471
MREVNFSIPNVNKASVGITTALYDRRALDCTSTLPLINSLNHLAYLTTSSARIRDILTVDGGIERLVCILKHGRS
KDMMGMWKWNLAFQCVVNIGVRGTENVRTRVVEADMVPVIATILDNYIKVIEKFREKAEEASQKQMHEHHRRNRA
QEHHASTKVSPVFPSRASRTELDQRSARRHGPPPIDISATSAGPSNATGLPNTVLASPRNFTGTPERPMSTSTRQ
SHSLRGSSGSLVGPPAPLPVQSLAAASLAMNGMDGWNRFGRDSERLVSMVSIGPAELASQPNSPTTPLPPPQLHS
PTVRPATTINNSRPRRRPSIRHQNSMAEHDDLHADSIPSDEPQDTDMTGTAESAVGIQDISMEDGDNMLAGASLQ
LTNPTVSETHQDAEAFNITHRGASVDGMIGNPANPTPPSQTALMAPSRRAGPNPAMPRYLLDRQIVPNSCALTAM
PREEDVLMSLQLLAYVSKYCGLRSYFQRSHLVPKLAIRKDFEFGEGDESELEEREPPADEEFLLPNNFNLFPLVE
KFTVRYHSTDMQYWAGVVMRNLCRKDDTRGGIRQCAFYQCGKWEEYTRQFAKCRRCRRTKYCSKECQKCAWAFHR
HWCVAASQ
Coding >Ophio5|471
ATGAGGGAAGTGAACTTCAGTATTCCAAATGTCAACAAGGCGTCGGTCGGCATCACTACCGCCCTTTACGATCGT
CGGGCGCTTGACTGTACCTCCACCCTCCCCCTGATCAACTCTTTGAACCATCTGGCCTATCTCACCACCTCGTCG
GCCCGCATACGCGACATCCTTACCGTTGATGGTGGAATCGAGCGTTTGGTCTGCATTCTTAAACATGGGCGAAGC
AAGGACATGATGGGCATGTGGAAGTGGAACCTGGCTTTTCAATGCGTGGTCAACATCGGAGTTCGAGGCACCGAG
AACGTCAGAACTCGCGTTGTGGAAGCTGACATGGTTCCCGTCATCGCCACTATCCTGGACAACTATATTAAAGTC
ATCGAGAAGTTTCGTGAGAAAGCGGAAGAGGCCAGTCAGAAACAGATGCATGAGCATCATCGGCGGAACCGAGCC
CAGGAACATCACGCATCCACCAAAGTGTCGCCTGTTTTCCCCAGCCGTGCTAGCCGCACCGAGCTCGACCAGCGA
TCGGCTCGTAGGCACGGCCCGCCCCCTATCGATATCTCGGCCACATCCGCTGGCCCTTCGAATGCGACCGGCCTG
CCCAATACCGTGTTAGCCTCTCCAAGGAATTTCACAGGCACACCTGAGCGACCCATGTCTACATCGACTCGCCAA
TCTCATAGTCTCCGCGGGTCGAGCGGCAGCCTAGTGGGACCTCCCGCTCCTCTTCCCGTTCAATCACTCGCTGCG
GCAAGCTTGGCCATGAACGGCATGGATGGGTGGAACCGGTTTGGACGTGATTCCGAACGTTTGGTGTCTATGGTG
TCAATTGGTCCGGCTGAGCTTGCCTCTCAGCCAAACTCACCGACTACCCCTCTTCCACCGCCTCAGTTGCATTCT
CCAACCGTTCGACCCGCTACAACCATCAATAATTCCAGGCCGCGGAGAAGGCCATCAATCAGGCATCAGAACTCC
ATGGCTGAGCACGACGACCTCCACGCAGACAGCATACCCTCAGACGAGCCGCAGGATACTGACATGACCGGCACT
GCCGAATCTGCAGTGGGCATTCAGGACATCTCAATGGAAGACGGCGACAATATGTTGGCTGGGGCATCCCTTCAG
TTGACCAATCCGACTGTATCCGAGACACACCAGGACGCCGAGGCTTTTAACATTACTCACCGCGGCGCCTCCGTT
GACGGCATGATTGGAAATCCCGCCAACCCAACACCACCCAGCCAAACCGCTTTAATGGCACCTTCGCGACGAGCG
GGTCCCAATCCTGCCATGCCACGGTATCTACTTGATCGTCAAATTGTGCCCAACTCTTGTGCCCTAACCGCAATG
CCACGCGAAGAGGATGTCCTGATGTCACTCCAGCTCCTTGCCTACGTTTCCAAGTACTGCGGTCTTCGTTCATAC
TTTCAGAGGAGTCACCTTGTCCCAAAGCTTGCCATCCGTAAGGATTTCGAATTTGGCGAGGGAGACGAGTCTGAG
TTGGAAGAGCGCGAACCACCCGCCGACGAGGAATTTCTTCTACCGAATAACTTTAATCTCTTTCCCCTCGTGGAA
AAGTTCACCGTCAGGTACCATAGCACCGACATGCAATACTGGGCAGGTGTTGTTATGCGGAATCTCTGCCGCAAG
GATGATACACGTGGCGGCATCCGACAGTGTGCGTTTTATCAATGCGGAAAGTGGGAAGAGTACACGCGGCAGTTT
GCCAAGTGTCGTCGATGCAGGCGCACCAAATACTGCAGCAAGGAATGCCAGAAATGCGCCTGGGCTTTCCATCGC
CACTGGTGTGTGGCTGCCTCACAA
Transcript >Ophio5|471
ATGAGGGAAGTGAACTTCAGTATTCCAAATGTCAACAAGGCGTCGGTCGGCATCACTACCGCCCTTTACGATCGT
CGGGCGCTTGACTGTACCTCCACCCTCCCCCTGATCAACTCTTTGAACCATCTGGCCTATCTCACCACCTCGTCG
GCCCGCATACGCGACATCCTTACCGTTGATGGTGGAATCGAGCGTTTGGTCTGCATTCTTAAACATGGGCGAAGC
AAGGACATGATGGGCATGTGGAAGTGGAACCTGGCTTTTCAATGCGTGGTCAACATCGGAGTTCGAGGCACCGAG
AACGTCAGAACTCGCGTTGTGGAAGCTGACATGGTTCCCGTCATCGCCACTATCCTGGACAACTATATTAAAGTC
ATCGAGAAGTTTCGTGAGAAAGCGGAAGAGGCCAGTCAGAAACAGATGCATGAGCATCATCGGCGGAACCGAGCC
CAGGAACATCACGCATCCACCAAAGTGTCGCCTGTTTTCCCCAGCCGTGCTAGCCGCACCGAGCTCGACCAGCGA
TCGGCTCGTAGGCACGGCCCGCCCCCTATCGATATCTCGGCCACATCCGCTGGCCCTTCGAATGCGACCGGCCTG
CCCAATACCGTGTTAGCCTCTCCAAGGAATTTCACAGGCACACCTGAGCGACCCATGTCTACATCGACTCGCCAA
TCTCATAGTCTCCGCGGGTCGAGCGGCAGCCTAGTGGGACCTCCCGCTCCTCTTCCCGTTCAATCACTCGCTGCG
GCAAGCTTGGCCATGAACGGCATGGATGGGTGGAACCGGTTTGGACGTGATTCCGAACGTTTGGTGTCTATGGTG
TCAATTGGTCCGGCTGAGCTTGCCTCTCAGCCAAACTCACCGACTACCCCTCTTCCACCGCCTCAGTTGCATTCT
CCAACCGTTCGACCCGCTACAACCATCAATAATTCCAGGCCGCGGAGAAGGCCATCAATCAGGCATCAGAACTCC
ATGGCTGAGCACGACGACCTCCACGCAGACAGCATACCCTCAGACGAGCCGCAGGATACTGACATGACCGGCACT
GCCGAATCTGCAGTGGGCATTCAGGACATCTCAATGGAAGACGGCGACAATATGTTGGCTGGGGCATCCCTTCAG
TTGACCAATCCGACTGTATCCGAGACACACCAGGACGCCGAGGCTTTTAACATTACTCACCGCGGCGCCTCCGTT
GACGGCATGATTGGAAATCCCGCCAACCCAACACCACCCAGCCAAACCGCTTTAATGGCACCTTCGCGACGAGCG
GGTCCCAATCCTGCCATGCCACGGTATCTACTTGATCGTCAAATTGTGCCCAACTCTTGTGCCCTAACCGCAATG
CCACGCGAAGAGGATGTCCTGATGTCACTCCAGCTCCTTGCCTACGTTTCCAAGTACTGCGGTCTTCGTTCATAC
TTTCAGAGGAGTCACCTTGTCCCAAAGCTTGCCATCCGTAAGGATTTCGAATTTGGCGAGGGAGACGAGTCTGAG
TTGGAAGAGCGCGAACCACCCGCCGACGAGGAATTTCTTCTACCGAATAACTTTAATCTCTTTCCCCTCGTGGAA
AAGTTCACCGTCAGGTACCATAGCACCGACATGCAATACTGGGCAGGTGTTGTTATGCGGAATCTCTGCCGCAAG
GATGATACACGTGGCGGCATCCGACAGTGTGCGTTTTATCAATGCGGAAAGTGGGAAGAGTACACGCGGCAGTTT
GCCAAGTGTCGTCGATGCAGGCGCACCAAATACTGCAGCAAGGAATGCCAGAAATGCGCCTGGGCTTTCCATCGC
CACTGGTGTGTGGCTGCCTCACAATAA
Gene >Ophio5|471
ATGAGGGAAGTGAACTTCAGTATTCCAAATGTCAACAAGGCGTCGGTCGGCATCACTACCGCCCTTTACGATCGT
CGGGCGCTTGACTGTACCTCCACCCTCCCCCTGATCAACTCTTTGAACCATCTGGCCTATCTCACCACCTCGTCG
GCCCGCATACGCGACATCCTTACCGTTGATGGTGGAATCGAGCGTTTGGTCTGCATTCTTAAACATGGGCGAAGC
AAGGACATGATGGGCATGTGGAAGTGGAACCTGGCTTTTCAATGCGTGGTCAACATCGGAGTTCGAGGCACCGAG
AACGTCAGAACTCGCGTTGTGGAAGCTGACATGGTTCCCGTCATCGCCACTATCCTGGACAACTATATTAAAGTC
ATCGAGAAGTTTCGTGAGAAAGCGGAAGAGGCCAGTCAGAAACAGATGCATGAGCATCATCGGCGGAACCGAGCC
CAGGAACATCACGCATCCACCAAAGTGTCGCCTGTTTTCCCCAGCCGTGCTAGCCGCACCGAGCTCGACCAGCGA
TCGGCTCGTAGGCACGGCCCGCCCCCTATCGATATCTCGGCCACATCCGCTGGCCCTTCGAATGCGACCGGCCTG
CCCAATACCGTGTTAGCCTCTCCAAGGAATTTCACAGGCACACCTGAGCGACCCATGTCTACATCGACTCGCCAA
TCTCATAGTCTCCGCGGGTCGAGCGGCAGCCTAGTGGGACCTCCCGCTCCTCTTCCCGTTCAATCACTCGCTGCG
GCAAGCTTGGCCATGAACGGCATGGATGGGTGGAACCGGTTTGGACGTGATTCCGAACGTTTGGTGTCTATGGTG
TCAATTGGTCCGGCTGAGCTTGCCTCTCAGCCAAACTCACCGACTACCCCTCTTCCACCGCCTCAGTTGCATTCT
CCAACCGTTCGACCCGCTACAACCATCAATAATTCCAGGCCGCGGAGAAGGCCATCAATCAGGCATCAGAACTCC
ATGGCTGAGCACGACGACCTCCACGCAGACAGCATACCCTCAGACGAGCCGCAGGATACTGACATGACCGGCACT
GCCGAATCTGCAGTGGGCATTCAGGACATCTCAATGGAAGACGGCGACAATATGTTGGCTGGGGCATCCCTTCAG
TTGACCAATCCGACTGTATCCGAGACACACCAGGACGCCGAGGCTTTTAACATTACTCACCGCGGCGCCTCCGTT
GACGGCATGATTGGAAATCCCGCCAACCCAACACCACCCAGCCAAACCGCTTTAATGGCACCTTCGCGACGAGCG
GGTCCCAATCCTGCCATGCCACGGTATCTACTTGATCGTCAAATTGTGCCCAACTCTTGTGCCCTAACCGCAATG
CCACGCGAAGAGGATGTCCTGATGTCACTCCAGCTCCTTGCCTACGTTTCCAAGTACTGCGGTCTTCGTTCATAC
TTTCAGAGGAGTCACCTTGTCCCAAAGCTTGCCATCCGTAAGGATTTCGAATTTGGCGAGGGAGACGAGTCTGAG
TTGGAAGAGCGCGAACCACCCGCCGACGAGGAATTTCTTCTACCGAATAACTTTAATCTCTTTCCCCTCGTGGAA
AAGTTCACCGTCAGGTACCATAGCACCGACATGCAATACTGGGCAGGTGTTGTTATGCGGAATCTCTGCCGCAAG
GATGATACACGTGGCGGCATCCGACAGTGTGCGTTTTATCAATGCGGAAAGTGGGAAGAGTACACGCGGCAGTTT
GCCAAGTGTCGTCGATGCAGGCGCACCAAATACTGCAGCAAGGAATGCCAGAAATGCGCCTGGGCTTTCCATCGC
CACTGGTGTGTGGCTGCCTCACAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail